LOADING...
   YP_095136.1;SP19086A
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
YP_095136.1    SP19086A            JCSG 418740 PDB Deposition 12-MAY-02              PDB id: 4ezi

Protein Sequence Information


TOPSAN
JCSG Internal annotations

ACCESSIONYP_095136.1
DESCRIPTIONPutative hydrolase, alpha-beta hydrolases fold
ORGANISMLegionella pneumophila subsp. pneumophila str. philadelphia 1
COMMENT 
DR UNIPROT;
DR SPTR;
DR GenBank;
DR PDB; 4EZI; Identical; 27-JUN-12; UNCHARACTERIZED PROTEIN;
DR FFAS; 412156; Fold and function assignment.
DR TVPC; YP_095136.1; Homologs in PDB, JCSG and SG center.
DR OVP; YP_095136.1; Ortholog view popup.
DR TPM; YP_095136.1; Target PDB monitor.
DR FSS; YP_095136.1; Target function coverage.
PROPERTY Residues: 403 aa
Molecule Weight: 45740.97 Dalton
Isoelectric Point: 5.54
Extinction Coefficient: 56730
Gravy Index: -.13
Number of Met residues: 15
Percentage of Met residues: 3.72 %
Number of Cys residues: 2
Percentage of Cys residues: 0.50 %
SEQUENCE  amino acids 403 aa
>YP_095136.1  gi|52841337|ref|YP_095136.1| hypothetical protein lpg1103 [Legionella pneumophila subsp. pneumophila
MVMKTMRLFKGILFTFCGIIFCFNSHAALEHEKLVNYIALGEFSRETAEIALKKMPPLDT
LTVHYDLQLYKINYKTQSPDGNLTIASGLVAMPIHPVGQVGIISYQHGTRFERNDVPSRN
NEKNYIYLAAYGNSAGYMTVMPDYLGLGDNELTLHPYVQAETLASSSIDMLFAAKELANR
LHYPISDKLYLAGYSEGGFSTIVMFEMLAKEYPDLPVSAVAPGSAPYGWEETMHFVMLEP
GPRATAYLAYFFYSLQTYKSYWSGFDEIFAPPYNTLIPELMDGYHAVDEILQALPQDPLL
IFQPKFSNGIISKTDRNTEILKINFNHYDFKPTAPLLLVGTKGDRDVPYAGAEMAYHSFR
KYSDFVWIKSVSDALDHVQAHPFVLKEQVDFFKQFERQEAMNK

CDS  cDNA 1212 bp
   1 atggttatga aaacgatgcg tttattcaaa gggattcttt ttacattttg cgggattatt    60
  61 ttttgcttta attcccatgc tgctctggag catgagaagc tggttaatta tattgctttg   120
 121 ggtgaatttt ccagggaaac agcagaaatc gctttaaaaa aaatgccgcc attagacacc   180
 181 cttacagtac attatgatct gcaattatat aaaattaatt ataaaaccca gtcaccagat   240
 241 ggaaatctga ctattgcctc aggattagtt gcaatgccaa ttcatcctgt ggggcaagtg   300
 301 ggaattatta gctatcagca tggcacccga tttgaacgca atgatgtacc ttccagaaat   360
 361 aatgaaaaaa actatatata ccttgctgcc tatggtaata gtgcaggtta tatgacggtg   420
 421 atgccagatt atcttggtct gggagataat gaattaacac tccaccctta tgttcaggca   480
 481 gaaactcttg ccagcagtag cattgatatg ttgtttgctg ctaaggagtt agccaacagg   540
 541 cttcattacc caataagcga taaattatat ctggcaggtt attcagaagg cggattctca   600
 601 actattgtaa tgtttgaaat gctggcaaaa gagtatcctg atttacctgt ctctgcggtt   660
 661 gccccaggtt cagctcctta tggctgggaa gaaaccatgc attttgtgat gttggaacca   720
 721 ggacctcgtg ctacagccta tttggcctat ttcttttatt ctctgcaaac ttataagagt   780
 781 tattggtctg gttttgacga aatttttgct cctccttaca atactcttat cccggaattg   840
 841 atggatggat atcatgctgt tgacgaaatt cttcaagcct taccacaaga tccgctgctt   900
 901 atttttcagc caaaattctc taatggaatt attagtaaga cagatagaaa taccgagatt   960
 961 ttaaaaatta attttaacca ctatgatttt aaacctacag ctcctttgtt attggttggc  1020
1021 actaaaggtg atcgtgatgt accttatgca ggagctgaaa tggcatatca ttcctttagg  1080
1081 aaatatagtg attttgtgtg gataaaatcc gtcagtgacg cattggatca tgtgcaagct  1140
1141 catccctttg tactcaaaga acaggtggat ttttttaaac aatttgagcg tcaagaagca  1200
1201 atgaataaat aa  1212
Target constructs
Download sequence in PIR or FASTA format
Chemical properties of sequence with tag

Notes

The start codon is a ATG/Methionine in most of sequences, but the GTG/V, TTG/L, CTG/I can be the start codons in some cases as expressing in E.coli. The start codon warning is labelled by RED color in sequence(sample: 10174951).

Protein sequence information contains the annotation contents from both of JCSG and SWISS-PROT. The SWISS-PROT/TrEMBL annotation is accessed from SWALL(SPTR) on the EBI SRS server. PDB homologes show both identical and highly similar proteins with released date and protein function.


Contact Webmaster JCSG Menu