LOADING...
   YP_094990.1;SP19432A
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
YP_094990.1    SP19432A            JCSG 418834 PDB Deposition 13-APR-30              PDB id: 4kh9

Protein Sequence Information


TOPSAN
JCSG Internal annotations

ACCESSIONYP_094990.1
DESCRIPTIONCASP Target
Description Hidden
ORGANISMLegionella pneumophila subsp. pneumophila str. philadelphia 1
COMMENT 
DR UNIPROT;
DR SPTR;
DR GenBank;
DR PDB; 4KH9; Identical; 03-JUL-13; HYPOTHETICAL PROTEIN;
DR FFAS; 412258; Fold and function assignment.
DR TVPC; YP_094990.1; Homologs in PDB, JCSG and SG center.
DR OVP; YP_094990.1; Ortholog view popup.
DR TPM; YP_094990.1; Target PDB monitor.
DR FSS; YP_094990.1; Target function coverage.
PROPERTY Residues: 392 aa
Molecule Weight: 44479.19 Dalton
Isoelectric Point: 7.12
Extinction Coefficient: 51800
Gravy Index: -.42
Number of Met residues: 4
Percentage of Met residues: 1.02 %
Number of Cys residues: 3
Percentage of Cys residues: 0.77 %
SEQUENCE  amino acids 392 aa
>YP_094990.1  gi|52841191|ref|YP_094990.1| hypothetical protein lpg0956 [Legionella pneumophila subsp. pneumophila
MKTAHLIWISAFCIAQAHAFTLPRQPTKAYECENCSQLSRENLHDKWEITNEPLNNNISN
VRRSYGYKERISLEQLQRGVIISTLAPGAVVRITPLQNKSIPELLIKTPKNQLLPLKEAS
SLYNQDDEVGNNPLAITKHQAMLQIKPELGYGKFILKSKDITNKYADAYMISVLDKFSIT
YLEVETDSLHYQYGDKLKATISLHNDITEYDVNDVDARLVGPKGQVISLNLTKLKSNVFE
GTATLDSELNDRGENWYLETDVQTEYGQEIIRRSGHTAFSYSIPSASLMNVKKLSSKPLT
FVVTVDVATASRYALQSVLFQKNGKGEARPIQTSQRAQWLEPGKHVLQFTFDNHNQLSDD
NLYLGYLRLIDYGQLKTVYQYNQPVKLSQLVD

CDS  cDNA 1179 bp
   1 atgaaaactg cccatcttat atggatatcc gcattttgta ttgcccaagc tcatgcgttt    60
  61 acattaccaa gacagccaac caaagcttat gaatgtgaga attgcagcca attatcacga   120
 121 gaaaacctgc acgataaatg ggaaattacc aatgaaccat taaacaacaa catcagtaat   180
 181 gttcgtagaa gttatggtta caaagaacgt atttctctgg aacaattaca acgcggagtt   240
 241 attatatcaa cattggctcc tggcgctgtc gttcgcatta cccctttgca aaataaatcc   300
 301 atcccggaat tacttatcaa aacgccaaaa aaccaactcc tgcccctgaa agaagcctct   360
 361 tctctctata atcaggatga cgaggttggc aataatcctt tagccattac aaaacaccag   420
 421 gctatgttac aaataaaacc tgaactgggg tacggaaaat ttatactaaa aagcaaggac   480
 481 attactaaca aatatgccga tgcttatatg attagtgtcc ttgataaatt ttccatcact   540
 541 tacctggagg ttgaaaccga ttctctccat taccagtatg gggataagct aaaagcgacc   600
 601 atatcgcttc acaatgatat cactgagtat gacgtcaatg acgttgatgc tcgacttgta   660
 661 ggccctaaag gtcaagtcat ttcgcttaat ctgaccaagt taaaatccaa tgtatttgaa   720
 721 ggaactgcca ctttggattc tgagttaaat gatcgcggcg aaaactggta cttagaaact   780
 781 gatgttcaaa cagaatacgg gcaagaaatc attagacgat ctggccatac agccttttca   840
 841 tactccattc cctcagccag tcttatgaat gtaaaaaaat tgtcctctaa acctttgact   900
 901 tttgttgtca ctgtagatgt tgcaactgca agccgatacg ctttacaaag tgtgttgttc   960
 961 caaaaaaatg gaaagggtga agccaggcct attcagacct cgcaaagagc gcagtggctt  1020
1021 gaacccggta agcatgtttt gcaatttacc tttgacaatc acaatcaatt atcggacgat  1080
1081 aacctctatc tgggttattt acgcttgata gactatgggc agttaaaaac tgtgtatcaa  1140
1141 tacaaccaac ctgtcaagct tagtcagtta gtggattaa  1179
Target constructs
Download sequence in PIR or FASTA format
Chemical properties of sequence with tag

Notes

The start codon is a ATG/Methionine in most of sequences, but the GTG/V, TTG/L, CTG/I can be the start codons in some cases as expressing in E.coli. The start codon warning is labelled by RED color in sequence(sample: 10174951).

Protein sequence information contains the annotation contents from both of JCSG and SWISS-PROT. The SWISS-PROT/TrEMBL annotation is accessed from SWALL(SPTR) on the EBI SRS server. PDB homologes show both identical and highly similar proteins with released date and protein function.


Contact Webmaster JCSG Menu