LOADING...
   YP_094174.1;SP19257A
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
YP_094174.1    SP19257A            JCSG 418787 PDB Deposition 15-JUL-17              PDB id: 5cnl

Protein Sequence Information


TOPSAN
JCSG Internal annotations

ACCESSIONYP_094174.1
DESCRIPTIONCASP Target
Description Hidden
ORGANISMLegionella pneumophila subsp. pneumophila str. philadelphia 1
COMMENT 
DR UNIPROT;
DR SPTR;
DR GenBank;
DR FFAS; 412211; Fold and function assignment.
DR TVPC; YP_094174.1; Homologs in PDB, JCSG and SG center.
DR OVP; YP_094174.1; Ortholog view popup.
DR TPM; YP_094174.1; Target PDB monitor.
DR FSS; YP_094174.1; Target function coverage.
PROPERTY Residues: 176 aa
Molecule Weight: 19485.44 Dalton
Isoelectric Point: 9.13
Extinction Coefficient: 29910
Gravy Index: -.21
Number of Met residues: 3
Percentage of Met residues: 1.70 %
Number of Cys residues: 2
Percentage of Cys residues: 1.14 %
SEQUENCE  amino acids 176 aa
>YP_094174.1  gi|52840375|ref|YP_094174.1| IcmL-like [Legionella pneumophila subsp. pneumophila str. Philadelphia 
MNKTITIALSLLLSIASKLTYAGPDRAQLAVWANEAIIATYTFDYKNYMQQQKEIAKYFS
ADGWIAYSKALNQSKLPEVVQKNAYFVNAVATEPPKLITLDPTHWQAIMPILVVYKNPQY
EQKQNLKVVLGFTVASPGQGVRGFSVTSLQSTPISPPCQCKIEETPGNTKQGDAKQ

CDS  cDNA 531 bp
   1 atgaacaaaa caatcacaat tgccttgagt ttacttctaa gtattgcctc aaaactaact    60
  61 tatgctgggc cagatagagc acaattggca gtttgggcta atgaggcgat tattgccact   120
 121 tacacttttg attataaaaa ttacatgcaa caacaaaagg aaatagccaa atatttttca   180
 181 gctgatggct ggatagccta tagcaaagcg cttaatcaat caaaactgcc tgaagtagta   240
 241 caaaaaaatg cctatttcgt caatgctgtt gccacagaac cacccaagct gatcaccctg   300
 301 gatccgacac actggcaagc tatcatgccc atactggtcg tatataaaaa cccccaatac   360
 361 gagcaaaaac aaaatttaaa agttgtatta gggtttaccg tagcatctcc cggacaaggt   420
 421 gtaagaggtt tcagcgtaac cagcctgcaa tccaccccca tcagcccgcc atgccaatgt   480
 481 aaaattgaag agacgcctgg gaatactaaa caaggagacg ccaaacaata a   531
Target constructs
Download sequence in PIR or FASTA format
Chemical properties of sequence with tag

Notes

The start codon is a ATG/Methionine in most of sequences, but the GTG/V, TTG/L, CTG/I can be the start codons in some cases as expressing in E.coli. The start codon warning is labelled by RED color in sequence(sample: 10174951).

Protein sequence information contains the annotation contents from both of JCSG and SWISS-PROT. The SWISS-PROT/TrEMBL annotation is accessed from SWALL(SPTR) on the EBI SRS server. PDB homologes show both identical and highly similar proteins with released date and protein function.


Contact Webmaster JCSG Menu