LOADING...
   YP_002938732.1;SP19388A
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
YP_002938732.1    SP19388A            JCSG 419660 PDB Deposition 15-JUL-21              PDB id: 5coz

Protein Sequence Information


TOPSAN
JCSG Internal annotations

ACCESSIONYP_002938732.1
DESCRIPTIONCASP Target
Description Hidden
ORGANISMEubacterium rectale atcc 33656
COMMENT 
DR UNIPROT;
DR SPTR;
DR GenBank;
DR FFAS; 411155; Fold and function assignment.
DR TVPC; YP_002938732.1; Homologs in PDB, JCSG and SG center.
DR OVP; YP_002938732.1; Ortholog view popup.
DR TPM; YP_002938732.1; Target PDB monitor.
DR FSS; YP_002938732.1; Target function coverage.
PROPERTY Residues: 381 aa
Molecule Weight: 43754.69 Dalton
Isoelectric Point: 4.41
Extinction Coefficient: 60740
Gravy Index: -.48
Number of Met residues: 8
Percentage of Met residues: 2.10 %
Number of Cys residues: 8
Percentage of Cys residues: 2.10 %
SEQUENCE  amino acids 381 aa
>YP_002938732.1  gi|238925215|ref|YP_002938732.1| hypothetical protein EUBREC_2869 [Eubacterium rectale ATCC 33656]
MKKICYIILILCFSLVSCAPTENVIDDGTQANTTDLNDYENVLNSLDEEQIGKLPQNIKC
VVNDKLNIDSEINIWDATSYYVKSGKVKAINFSENKDKCYDLMEKLAKAINLNKDVCVQS
HRSENGNEIYLWDNNYTQDSIAIRNDSALAETHDGKLAVSASKFGTYYSPFNDKDKFRTD
KQLMFMSAEEAEELAVKTAKELEINVCEKNELYVLDDKNTLIFPEDDTDKQNDTYVFFMF
PDVYGIPYSRCPENEALTGYANQENHLVIAMDEKGISFLDIPPLYDWVETTETGEILHPS
SILSKEVDKLKKYVTSGDIEVSEISLEYMLFADKNETYDIKPVWVVYYYQNQLVTGENSY
TQKMALYDVYDAYTGEEYRIQ

CDS  cDNA 1146 bp
   1 atgaagaaaa tctgctatat aatacttata ctatgttttt cacttgttag ttgtgcacca    60
  61 actgaaaacg taatagatga tggtacacaa gctaatacca cagacttaaa tgattatgaa   120
 121 aatgtgctaa attctttgga cgaagaacag ataggaaaac ttccacaaaa tataaaatgc   180
 181 gttgtaaatg ataagctgaa cattgattca gaaattaata tctgggatgc aacaagttat   240
 241 tacgttaaaa gtggaaaagt taaggctatt aatttttcgg aaaataagga taaatgctat   300
 301 gatctgatgg aaaaattagc aaaagcgatt aatctaaata aggatgtatg tgtacaaagc   360
 361 cacagatcgg agaatggtaa tgagatttat ttatgggata acaattatac tcaggatagc   420
 421 atagcaatca gaaatgattc agctttagcc gagacgcatg acggaaagct tgctgttagt   480
 481 gcgtctaaat ttggcacata ttactcaccg tttaatgata aagataagtt tagaactgac   540
 541 aaacaactaa tgtttatgtc tgccgaagag gcggaagaat tagcggttaa aacagcgaaa   600
 601 gaacttgaaa ttaatgtttg tgaaaaaaat gaattatacg ttcttgatga caaaaataca   660
 661 ttaatatttc cagaggatga tacagataaa caaaatgata catatgtatt ttttatgttt   720
 721 ccggacgtgt atggtattcc atatagcaga tgccctgaaa atgaagcgtt aacgggttat   780
 781 gcaaatcaag aaaatcattt ggtaatagct atggatgaaa agggaatttc gtttttagat   840
 841 attccaccat tgtatgattg ggtcgagaca actgagactg gtgagatatt acatccatcg   900
 901 tctatacttt caaaagaggt tgataaacta aaaaaatacg taacatccgg ggatattgag   960
 961 gtaagcgaaa tatcattaga atatatgttg tttgcagata aaaatgaaac ttatgatatt  1020
1021 aagcctgttt gggtggttta ctactatcaa aaccaattgg tgacaggaga aaacagttat  1080
1081 acgcaaaaaa tggctcttta tgatgtatat gacgcatata caggggagga atatagaata  1140
1141 caatga  1146
Target constructs
Download sequence in PIR or FASTA format
Chemical properties of sequence with tag

Notes

The start codon is a ATG/Methionine in most of sequences, but the GTG/V, TTG/L, CTG/I can be the start codons in some cases as expressing in E.coli. The start codon warning is labelled by RED color in sequence(sample: 10174951).

Protein sequence information contains the annotation contents from both of JCSG and SWISS-PROT. The SWISS-PROT/TrEMBL annotation is accessed from SWALL(SPTR) on the EBI SRS server. PDB homologes show both identical and highly similar proteins with released date and protein function.


Contact Webmaster JCSG Menu