LOADING...
   YP_002937094.1;SP19397A
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
YP_002937094.1    SP19397A            JCSG 419666 PDB Deposition 13-AUG-19              PDB id: 2mca

Protein Sequence Information


TOPSAN
JCSG Internal annotations

ACCESSIONYP_002937094.1
DESCRIPTIONNMR structure of the protein YP_002937094.1
ORGANISMEubacterium rectale atcc 33656
COMMENT 
DR UNIPROT;
DR SPTR;
DR GenBank;
DR PDB; 2MCA; Identical; 04-SEP-13; UNCHARACTERIZED PROTEIN;
DR FFAS; 411169; Fold and function assignment.
DR TVPC; YP_002937094.1; Homologs in PDB, JCSG and SG center.
DR OVP; YP_002937094.1; Ortholog view popup.
DR TPM; YP_002937094.1; Target PDB monitor.
DR FSS; YP_002937094.1; Target function coverage.
PROPERTY Residues: 133 aa
Molecule Weight: 14609.84 Dalton
Isoelectric Point: 5.32
Extinction Coefficient: 9970
Gravy Index: -.16
Number of Met residues: 3
Percentage of Met residues: 2.26 %
Number of Cys residues: 1
Percentage of Cys residues: 0.75 %
SEQUENCE  amino acids 133 aa
>YP_002937094.1  gi|238923578|ref|YP_002937094.1| hypothetical protein EUBREC_1200 [Eubacterium rectale ATCC 33656]
MNKIIKKQVLATFALVTIMAGVLIGTNCIYAAQDGKETTTIRLINQTYFNVKNIKVTWND
GKEQTVNTLGSHDSIDFSSDAGSVYKMDVTGTTQSGEKFTGHFKGLVGKDTRVFIELDEN
ADVQVFIPQGEID

CDS  cDNA 402 bp
   1 atgaataaaa taataaaaaa acaagttctt gctacgtttg cattagttac tatcatggca    60
  61 ggagtgttaa taggtactaa ttgtatttat gcagcgcagg acggaaaaga gacaacaact   120
 121 atccggctta taaaccagac ttattttaat gttaagaata tcaaggtaac ctggaacgat   180
 181 ggcaaagagc agactgtcaa cacacttggc agccatgatt caattgattt ctcatcagat   240
 241 gccggaagcg tatacaaaat ggatgttacc ggaacaaccc agtccggaga gaaattcacc   300
 301 ggacatttta agggactggt cggcaaagat acaagagtat ttatagagct tgacgagaat   360
 361 gctgatgttc aggtttttat cccacaggga gaaattgatt aa   402
Target constructs
Download sequence in PIR or FASTA format
Chemical properties of sequence with tag

Notes

The start codon is a ATG/Methionine in most of sequences, but the GTG/V, TTG/L, CTG/I can be the start codons in some cases as expressing in E.coli. The start codon warning is labelled by RED color in sequence(sample: 10174951).

Protein sequence information contains the annotation contents from both of JCSG and SWISS-PROT. The SWISS-PROT/TrEMBL annotation is accessed from SWALL(SPTR) on the EBI SRS server. PDB homologes show both identical and highly similar proteins with released date and protein function.


Contact Webmaster JCSG Menu