LOADING...
   YP_002935947.1;MH15438A
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
YP_002935947.1    MH15438A            JCSG 394339 PDB Deposition 11-JUL-20              PDB id: 3t0p

Protein Sequence Information


TOPSAN
JCSG Internal annotations

ACCESSIONYP_002935947.1
DESCRIPTIONPutative DNA polymerase III beta subunit
ORGANISMEubacterium rectale atcc 33656
COMMENT-Gene Name
Note I could not enter to NCBI/uniprot with Protein Accession: RER070207000121, I had to do a blast search and I got 100% seq identity in the following two cases: (1) gene EUBREC_0002 from Eubacterium rectale (strain ATCC 33656 / VPI 0990) and (2) gene ERE_29750 from Eubacterium rectale M104/1

FFAS, against Pfam, three significant hits DNA polymerase III beta subunit, N-terminal domain (PF00712, score -54.700); DNA polymerase III beta sub
unit, central domain (PF02767, score -53.400) and DNA polymerase III beta subunit, C-terminal domain (PF02768, score -50.400)

Fatcat top hit DNA polymerase III, beta chain (2awaA, P-value 0.00e+00)
DR UNIPROT;
DR SPTR;
DR GenBank;
DR Pfam; PF02767; DNA_pol3_beta_2;
DR Pfam; PF00712; DNA_pol3_beta;
DR Pfam; PF02768; DNA_pol3_beta_3;
DR PDB; 3T0P; Identical; 10-AUG-11; DNA POLYMERASE III, BETA SUBUNIT;
DR PDB; 4TR6; Highly similar; 10-SEP-14; DNA POLYMERASE III SUBUNIT BETA;
DR KEGG; 2.7.7.7; Enzyme page
DR FFAS; 394339; Fold and function assignment.
DR TVPC; YP_002935947.1; Homologs in PDB, JCSG and SG center.
DR OVP; YP_002935947.1; Ortholog view popup.
DR TPM; YP_002935947.1; Target PDB monitor.
DR FSS; YP_002935947.1; Target function coverage.
PROPERTY Residues: 370 aa
Molecule Weight: 41901.05 Dalton
Isoelectric Point: 4.8
Extinction Coefficient: 13410
Gravy Index: -.08
Number of Met residues: 12
Percentage of Met residues: 3.24 %
Number of Cys residues: 5
Percentage of Cys residues: 1.35 %
SEQUENCE  amino acids 370 aa
>YP_002935947.1  gi|238922434|ref|YP_002935947.1| DNA polymerase III, beta subunit [Eubacterium rectale ATCC 33656]
MKLICSKANLLKGVNIVSKAVPTRTTMAILECILIDASANEIKLMANDMELGIETIIDGT
IEERGIIALDAKIFSEIVRKLPDNDVTIETDASFKTVISCEKAKFNIIGKSGDDFSYIPY
VERNESIVLSQFTLKEVIRQTIFSIADNDNNKLMTGELFEIEENKLRVVSLDGHRISIRY
IEMKNHYDSKKVVVPGKTLQEISKIIPGSADEDVVIYITNNHIVFEFENTTVVSRLIEGE
YFKIDQMLSSDYDTKVRINKRELLDCIDRATLLVKEGDKKPIIMNITDGNMELRINSFIG
SMNEDIDIDKDGKDIMIGFNPKFFIDALRVIDEEEVNLYMVNPKAPCFIKDDEGKFIYLI
LPVNFNTAAN

CDS  cDNA 1113 bp
   1 atgaaactta tttgttcaaa agcaaattta ctgaaaggtg ttaatatcgt atcgaaggca    60
  61 gtacctacac gtactacaat ggcaattctc gagtgcatac ttattgatgc atccgcaaac   120
 121 gagattaagc ttatggctaa cgatatggag cttggaatcg aaacaataat agacggaact   180
 181 atcgaagaga gaggaattat cgctcttgat gccaagattt tttcagaaat agtgagaaag   240
 241 cttcctgaca atgatgtaac aattgagaca gatgcttcct tcaagaccgt catatcatgt   300
 301 gaaaaggcca agttcaatat catcggaaaa tcaggtgatg atttttctta cataccatat   360
 361 gttgagagaa atgagtctat tgtcctttca caatttaccc ttaaagaggt tatcagacag   420
 421 acaattttct caattgccga caatgacaac aataaactga tgacaggtga gctttttgag   480
 481 attgaggaga ataagcttcg agttgtttct cttgacggac acagaatatc tatcagatat   540
 541 atcgagatga aaaatcacta tgacagcaag aaggttgttg ttcccggcaa gactctgcag   600
 601 gaaataagca agattattcc gggttcagcg gatgaggatg tggttatcta tatcactaac   660
 661 aatcatattg tttttgaatt tgaaaatact actgttgttt cacgtcttat cgagggtgag   720
 721 tatttcaaga ttgaccagat gctttcatct gactacgaca ctaaggttcg catcaataag   780
 781 cgtgagcttc ttgactgtat agatcgtgct actcttcttg tcaaggaggg agataagaag   840
 841 cctattatca tgaatatcac agatggcaat atggagcttc gcatcaattc atttatcggt   900
 901 tccatgaatg aggacatcga tatcgacaaa gatggaaaag atattatgat aggctttaat   960
 961 cctaagttct tcatagatgc acttcgtgtt atcgatgagg aggaggttaa tttatacatg  1020
1021 gtcaatccaa aggcaccatg cttcattaag gatgatgagg gcaagtttat ttacctcatt  1080
1081 cttccggtaa attttaatac agcagcaaac tag  1113
Target constructs
Download sequence in PIR or FASTA format
Chemical properties of sequence with tag

Notes

The start codon is a ATG/Methionine in most of sequences, but the GTG/V, TTG/L, CTG/I can be the start codons in some cases as expressing in E.coli. The start codon warning is labelled by RED color in sequence(sample: 10174951).

Protein sequence information contains the annotation contents from both of JCSG and SWISS-PROT. The SWISS-PROT/TrEMBL annotation is accessed from SWALL(SPTR) on the EBI SRS server. PDB homologes show both identical and highly similar proteins with released date and protein function.


Contact Webmaster JCSG Menu