LOADING...
   YP_001715502.1;SP17326A
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
YP_001715502.1    SP17326A            JCSG 420464 PDB Deposition 13-JUN-06              PDB id: 4l3u

Protein Sequence Information


TOPSAN
JCSG Internal annotations

ACCESSIONYP_001715502.1
DESCRIPTIONCASP Target
Description Hidden
ORGANISMAcinetobacter baumannii aye
COMMENT 
DR UNIPROT;
DR SPTR;
DR GenBank;
DR PDB; 4L3U; Identical; 31-JUL-13; UNCHARACTERIZED PROTEIN;
DR FFAS; 406463; Fold and function assignment.
DR TVPC; YP_001715502.1; Homologs in PDB, JCSG and SG center.
DR OVP; YP_001715502.1; Ortholog view popup.
DR TPM; YP_001715502.1; Target PDB monitor.
DR FSS; YP_001715502.1; Target function coverage.
PROPERTY Residues: 157 aa
Molecule Weight: 17489.94 Dalton
Isoelectric Point: 4.83
Extinction Coefficient: 9970
Gravy Index: -.34
Number of Met residues: 4
Percentage of Met residues: 2.55 %
Number of Cys residues: 1
Percentage of Cys residues: 0.64 %
SEQUENCE  amino acids 157 aa
>YP_001715502.1  gi|169797709|ref|YP_001715502.1| hypothetical protein ABAYE3784 [Acinetobacter baumannii AYE]
MKKLLVLVMAVLSSQVGCAQKTENKTEMSIQNSNSIVIQQLEKFKAQDHFAGDGQLYTGV
QNSALRMSLNQKVADTAQAFIALYQQKNEPTKAELLQVLANGISQIDPDKLDTEDREQVA
TTFESFLDIVGLESSEGILNKWVYGEEISKLLEQDKH

CDS  cDNA 474 bp
   1 atgaaaaagc ttttggttct agtcatggct gtcttaagtt cacaagttgg ttgtgcccaa    60
  61 aaaactgaga ataaaacaga aatgagtatt caaaattcta actctattgt tattcaacaa   120
 121 ttagaaaagt ttaaagctca agatcatttt gcgggagatg gtcagctata tacaggggtt   180
 181 caaaattctg cattacgtat gagtttgaat caaaaagtgg ctgatactgc acaagctttt   240
 241 attgcacttt atcaacaaaa gaatgagcca accaaggcag aacttttaca agtccttgct   300
 301 aatggaatta gtcaaatcga tcctgacaag ttggatacag aagatcgaga acaagtggca   360
 361 actacatttg aaagttttct agatattgta ggcctagaaa gttcagaagg tattttaaat   420
 421 aaatgggtat acggtgaaga aattagtaag ttattggagc aagataaaca ttaa   474
Target constructs
Download sequence in PIR or FASTA format
Chemical properties of sequence with tag

Notes

The start codon is a ATG/Methionine in most of sequences, but the GTG/V, TTG/L, CTG/I can be the start codons in some cases as expressing in E.coli. The start codon warning is labelled by RED color in sequence(sample: 10174951).

Protein sequence information contains the annotation contents from both of JCSG and SWISS-PROT. The SWISS-PROT/TrEMBL annotation is accessed from SWALL(SPTR) on the EBI SRS server. PDB homologes show both identical and highly similar proteins with released date and protein function.


Contact Webmaster JCSG Menu