LOADING...
   YP_001714923.1;SP17227A
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
YP_001714923.1    SP17227A            JCSG 420424 PDB Deposition 14-MAR-14              PDB id: 2mmb

Protein Sequence Information


TOPSAN
JCSG Internal annotations

ACCESSIONYP_001714923.1
DESCRIPTIONNMR structure of DUF4951 family protein, PF16309 family
ORGANISMAcinetobacter baumannii aye
COMMENTThe target is the first structural representative of PF16309 family, mainly found in various
Acinetobacter baumannii species
DR UNIPROT;
DR SPTR;
DR GenBank;
DR PDB; 2MMB; Identical; 23-APR-14; UNCHARACTERIZED PROTEIN;
DR FFAS; 406416; Fold and function assignment.
DR TVPC; YP_001714923.1; Homologs in PDB, JCSG and SG center.
DR OVP; YP_001714923.1; Ortholog view popup.
DR TPM; YP_001714923.1; Target PDB monitor.
DR FSS; YP_001714923.1; Target function coverage.
PROPERTY Residues: 125 aa
Molecule Weight: 14348.77 Dalton
Isoelectric Point: 9.23
Extinction Coefficient: 27960
Gravy Index: -.49
Number of Met residues: 4
Percentage of Met residues: 3.20 %
Number of Cys residues: 2
Percentage of Cys residues: 1.60 %
SEQUENCE  amino acids 125 aa
>YP_001714923.1  gi|169797130|ref|YP_001714923.1| hypothetical protein ABAYE3142 [Acinetobacter baumannii AYE]
MWKYLFSIFCLGANIHCYATDFGTTNNFVSPNLQLKQNVLPPTPKNIPLPAFGQRIIGWG
TGAEGARQRLENIQPADVSMIKKQGTTLEMITAWQDFYEQEQQRNENNPTAKYRARLMKK
IADLW

CDS  cDNA 378 bp
   1 atgtggaaat acttatttag cattttttgc ttaggggcaa atattcactg ttatgcgact    60
  61 gatttcggga caacgaataa ttttgtctct ccaaatttgc agcttaaaca aaatgtactt   120
 121 cctcctactc caaaaaatat tcctctgcct gcttttggcc agcggattat tggttggggg   180
 181 acaggagcag aaggtgccag acagcgttta gagaatattc agcctgccga tgtttctatg   240
 241 attaaaaaac aaggaacaac tttagaaatg atcacggcct ggcaagattt ttatgaacaa   300
 301 gagcaacaac gtaatgaaaa taatccaact gcaaaatatc gtgctcgttt aatgaaaaaa   360
 361 attgccgacc tttggtaa   378
Target constructs
Download sequence in PIR or FASTA format
Chemical properties of sequence with tag

Notes

The start codon is a ATG/Methionine in most of sequences, but the GTG/V, TTG/L, CTG/I can be the start codons in some cases as expressing in E.coli. The start codon warning is labelled by RED color in sequence(sample: 10174951).

Protein sequence information contains the annotation contents from both of JCSG and SWISS-PROT. The SWISS-PROT/TrEMBL annotation is accessed from SWALL(SPTR) on the EBI SRS server. PDB homologes show both identical and highly similar proteins with released date and protein function.


Contact Webmaster JCSG Menu