LOADING...
   YP_001714613.1;SP4101A
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
YP_001714613.1    SP4101A            JCSG 420351 PDB Deposition 14-FEB-05              PDB id: 4opm

Protein Sequence Information


TOPSAN
JCSG Internal annotations

ACCESSIONYP_001714613.1
DESCRIPTIONCASP Target
Description Hidden
ORGANISMAcinetobacter baumannii aye
COMMENT 
DR UNIPROT;
DR SPTR;
DR GenBank;
DR Pfam; PF00561; Abhydrolase_1;
DR PDB; 4OPM; Identical; 19-FEB-14; LIPASE;
DR PDB; 4NS4; Highly similar; 07-JAN-15; ALPHA/BETA HYDROLASE FOLD PROTEIN;
DR PDB; 2XMZ; Highly similar; 25-MAY-11; HYDROLASE, ALPHA/BETA HYDROLASE FOLD FAMILY;
DR FFAS; 406330; Fold and function assignment.
DR TVPC; YP_001714613.1; Homologs in PDB, JCSG and SG center.
DR OVP; YP_001714613.1; Ortholog view popup.
DR TPM; YP_001714613.1; Target PDB monitor.
DR FSS; YP_001714613.1; Target function coverage.
PROPERTY Residues: 330 aa
Molecule Weight: 36598.29 Dalton
Isoelectric Point: 8.71
Extinction Coefficient: 38390
Gravy Index: -.09
Number of Met residues: 5
Percentage of Met residues: 1.52 %
Number of Cys residues: 1
Percentage of Cys residues: 0.30 %
SEQUENCE  amino acids 330 aa
>YP_001714613.1  gi|169796820|ref|YP_001714613.1| lipase [Acinetobacter baumannii AYE]
MKKTATALTLACSLLSVMSISQAQAADNIDVSFQTILQQERNWAGLQSKSLKVGDITWSY
SEGGSSTKPTLLLIHGLAGSRDNWNRVAHYLTTNYHVIIPDLPGSGETIVSQDFDYSVPN
LAEKLRRFVEAANLKGPIHIAGHSLGGSIALLYAGQYPFETKSLFLVDSGGIFRSANTIY
LKDPTYLKQLLVSKKGDFNYLLKQTMFNPPFIPKEFLQAQEKLMINQAPQTQKLVDQLIA
LNKVYTPDSFAVLTKTIDAPTLILWGKQDKIINVEVANELKRLLKNAQPPVILENVGHMP
ILEAEQLVIQQYVPFLLKVETNQSSKTTTP

CDS  cDNA 993 bp
   1 atgaaaaaaa ctgctactgc actgactttg gcttgtagct tattgtcagt catgagcatt    60
  61 tctcaagcgc aggcagccga taatattgat gtcagctttc aaacaatatt acagcaggaa   120
 121 cgtaactggg caggactgca aagcaaaagc ctaaaggtgg gcgatatcac ttggtcatat   180
 181 agtgaaggtg gctctagcac aaagccaact ttactactca ttcatggcct agcgggcagt   240
 241 cgagataact ggaaccgagt tgcccattat ctcacgacaa attatcacgt tattattcct   300
 301 gacttaccgg gcagtggcga aactatcgtt tcgcaagact ttgattattc ggttcccaac   360
 361 ttagctgaaa aattacgtcg ctttgttgaa gccgccaatt taaaaggccc aattcatatt   420
 421 gctgggcact cactcggcgg atctattgcc ctactctatg ctggacaata tccatttgaa   480
 481 accaaaagtc tatttttagt cgatagcggt ggtattttcc gttctgccaa cacaatttat   540
 541 ctaaaagatc caacctatct aaaacaactt ttagtctcta aaaaaggtga ttttaattat   600
 601 ttattaaaac aaaccatgtt taatcctccg tttattccta aagagttcct gcaagctcaa   660
 661 gaaaaactga tgattaatca agcacctcaa acacagaaac tggttgatca attgattgca   720
 721 ctcaataaag tctatacccc agattcattt gccgtactta ctaaaacgat tgacgcccct   780
 781 acactcattt tatggggtaa acaggataaa attattaatg tagaagtagc aaacgagcta   840
 841 aaacggcttt taaaaaatgc ccagcctcca gttatcttag aaaacgtagg tcatatgcca   900
 901 attttggaag ctgaacagtt agttatccaa caatacgtac cgtttttact gaaagtagaa   960
 961 acaaaccagt cgtcaaaaac gacaacacct taa   993
Target constructs
Download sequence in PIR or FASTA format
Chemical properties of sequence with tag

Notes

The start codon is a ATG/Methionine in most of sequences, but the GTG/V, TTG/L, CTG/I can be the start codons in some cases as expressing in E.coli. The start codon warning is labelled by RED color in sequence(sample: 10174951).

Protein sequence information contains the annotation contents from both of JCSG and SWISS-PROT. The SWISS-PROT/TrEMBL annotation is accessed from SWALL(SPTR) on the EBI SRS server. PDB homologes show both identical and highly similar proteins with released date and protein function.


Contact Webmaster JCSG Menu