LOADING...
   YP_001714444.1;SP17106A
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
YP_001714444.1    SP17106A            JCSG 420366 PDB Deposition 14-MAR-14              PDB id: 4pux

Protein Sequence Information


TOPSAN
JCSG Internal annotations

ACCESSIONYP_001714444.1
DESCRIPTIONCASP Target
Description Hidden
ORGANISMAcinetobacter baumannii aye
COMMENT 
DR UNIPROT;
DR SPTR;
DR GenBank;
DR PDB; 4PUX; Identical; 18-JUN-14; UNCHARACTERIZED PROTEIN;
DR PDB; 3C5O; Highly similar; 19-FEB-08; UPF0311 PROTEIN RPA1785;
DR PDB; 3G7G; Highly similar; 17-MAR-09; UPF0311 PROTEIN CA_C3321;
DR FFAS; 406346; Fold and function assignment.
DR TVPC; YP_001714444.1; Homologs in PDB, JCSG and SG center.
DR OVP; YP_001714444.1; Ortholog view popup.
DR TPM; YP_001714444.1; Target PDB monitor.
DR FSS; YP_001714444.1; Target function coverage.
PROPERTY Residues: 178 aa
Molecule Weight: 19671.65 Dalton
Isoelectric Point: 8.97
Extinction Coefficient: 29910
Gravy Index: -.19
Number of Met residues: 3
Percentage of Met residues: 1.69 %
Number of Cys residues: 2
Percentage of Cys residues: 1.12 %
SEQUENCE  amino acids 178 aa
>YP_001714444.1  gi|169796651|ref|YP_001714444.1| hypothetical protein ABAYE2633 [Acinetobacter baumannii AYE]
MKKVVTLLCGICLIGLTHAETQYNPPPIQLEPLAKFSVDLNAPVWELGTTSDAGKRRIIP
ITGGTFEGKSLKGRILNNGADWQIVDSKGLAIIDTRYLLETDDGALIYLQTKGYRHGSAE
TLKQLAQGKDVDPKNYYFKITMQFETSSPKYSWLNQTVAVGSAMRLGKAVIYDAYTLK

CDS  cDNA 537 bp
   1 atgaagaaag ttgtaacact actctgcgga atttgtctca ttggcctaac tcatgccgaa    60
  61 actcaatata acccaccacc tattcagctt gagcctttag caaaatttag tgttgattta   120
 121 aatgctcctg tttgggagtt aggtaccacc agtgatgcag gtaaacgccg aattattccc   180
 181 attacaggtg ggacattcga aggcaaatca cttaaaggcc gcattttaaa taatggtgca   240
 241 gattggcaaa ttgtcgacag taaaggacta gccattattg atacgcgata tttgttagaa   300
 301 accgatgacg gtgcgcttat ttaccttcaa accaaaggtt accgccatgg ctcggcagag   360
 361 acgctaaaac aacttgccca aggcaaagat gtcgacccga aaaattacta tttcaaaatt   420
 421 accatgcagt ttgaaaccag ctcacctaaa tactcatggc ttaaccagac cgttgcggta   480
 481 ggtagtgcaa tgcgcttggg caaagcggtt atttatgatg cctataccct gaaataa   537
Target constructs
Download sequence in PIR or FASTA format
Chemical properties of sequence with tag

Notes

The start codon is a ATG/Methionine in most of sequences, but the GTG/V, TTG/L, CTG/I can be the start codons in some cases as expressing in E.coli. The start codon warning is labelled by RED color in sequence(sample: 10174951).

Protein sequence information contains the annotation contents from both of JCSG and SWISS-PROT. The SWISS-PROT/TrEMBL annotation is accessed from SWALL(SPTR) on the EBI SRS server. PDB homologes show both identical and highly similar proteins with released date and protein function.


Contact Webmaster JCSG Menu