LOADING...
   YP_001714229.1;SP2417A
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
YP_001714229.1    SP2417A            JCSG 420360 PDB Deposition 15-AUG-10              PDB id: 5d66

Protein Sequence Information


TOPSAN
JCSG Internal annotations

ACCESSIONYP_001714229.1
DESCRIPTIONCASP Target
Description Hidden
ORGANISMAcinetobacter baumannii aye
COMMENT 
DR UNIPROT;
DR SPTR;
DR GenBank;
DR Pfam; PF00023; Ank;
DR PDB; 3HRA; Highly similar; 16-JUN-10; ANKYRIN REPEAT FAMILY PROTEIN;
DR PDB; 4HQD; Highly similar; 14-NOV-12; ENGINEERED PROTEIN OR265;
DR PDB; 4HB5; Highly similar; 10-OCT-12; ENGINEERED PROTEIN;
DR PDB; 4GPM; Highly similar; 05-SEP-12; ENGINEERED PROTEIN OR264;
DR PDB; 4GMR; Highly similar; 29-AUG-12; OR266 DE NOVO PROTEIN;
DR PDB; 4HLL; Highly similar; 23-OCT-13; ANKYRIN(GAG)1D4;
DR PDB; 4YDW; Highly similar; 04-MAR-15; DARPIN 44C12V5;
DR PDB; 4YDY; Highly similar; 04-MAR-15; DARPIN 44C12V5;
DR FFAS; 406340; Fold and function assignment.
DR TVPC; YP_001714229.1; Homologs in PDB, JCSG and SG center.
DR OVP; YP_001714229.1; Ortholog view popup.
DR TPM; YP_001714229.1; Target PDB monitor.
DR FSS; YP_001714229.1; Target function coverage.
PROPERTY Residues: 236 aa
Molecule Weight: 25667.25 Dalton
Isoelectric Point: 8.47
Extinction Coefficient: 24410
Gravy Index: .04
Number of Met residues: 8
Percentage of Met residues: 3.39 %
Number of Cys residues: 2
Percentage of Cys residues: 0.85 %
SEQUENCE  amino acids 236 aa
>YP_001714229.1  gi|169796436|ref|YP_001714229.1| ankyrin repeat-containing protein [Acinetobacter baumannii AYE]
MPNCYAIHFYLECFMRKSLIWINLIIAMGALGFTNAVNAKDEYPLHMAAANDDIQLIKHI
LSQKTLIDARDETGSTALMVATRANNIHAAHMLIEAGADVNAKDNIQDSPYLYAGAQGYL
KILRMTLMHGADLKSTNRYGGTALIPAAERGHVETVRTLIAAGVNVNHVNNLGWTALLEA
IILGNGKSNYQQIVALLLKAGANPNLADKDGITPLQHARTRGYREIEKLLLVAGAK

CDS  cDNA 711 bp
   1 gtgccaaatt gttatgcaat tcatttttat ttggagtgtt tcatgcgtaa gtccctcata    60
  61 tggatcaatc tgatcattgc gatgggcgct ttgggtttta caaatgcggt aaatgcaaaa   120
 121 gatgaatacc ctttacacat ggcagctgca aatgacgata ttcagttaat aaaacatatt   180
 181 ttgtctcaaa agaccttaat tgatgcacgt gatgaaacag gttcaacagc attaatggtg   240
 241 gcaacaagag caaacaatat acatgctgct catatgttga ttgaggccgg cgcagatgta   300
 301 aatgcgaaag ataatataca agatagtcct tatttgtatg caggcgcaca aggttattta   360
 361 aaaattttac gaatgacact catgcatggt gccgatttaa agagtactaa ccgttatggg   420
 421 ggaaccgcgc ttattccagc agcagaacgg ggccatgtag aaactgtccg tactttaatt   480
 481 gccgcaggtg taaacgtaaa tcatgtcaat aatttaggtt ggacagcttt actagaagca   540
 541 atcattttag gtaatggcaa atccaactat cagcaaattg tggcgctttt gctaaaagct   600
 601 ggtgccaatc cgaatttggc agataaagat gggatcacac cattacaaca tgcacgtaca   660
 661 agaggatatc gcgaaattga aaaactcctt cttgtagcag gtgcaaaata g   711
Warning: the change of start codon from ATG/M to GTG/V;
Target constructs
Download sequence in PIR or FASTA format
Chemical properties of sequence with tag

Notes

The start codon is a ATG/Methionine in most of sequences, but the GTG/V, TTG/L, CTG/I can be the start codons in some cases as expressing in E.coli. The start codon warning is labelled by RED color in sequence(sample: 10174951).

Protein sequence information contains the annotation contents from both of JCSG and SWISS-PROT. The SWISS-PROT/TrEMBL annotation is accessed from SWALL(SPTR) on the EBI SRS server. PDB homologes show both identical and highly similar proteins with released date and protein function.


Contact Webmaster JCSG Menu