LOADING...
   YP_001635819.1;MI10991B
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
YP_001635819.1    MI10991B            JCSG 399264 PDB Deposition 11-JAN-13              PDB id: 3qbm

Protein Sequence Information


TOPSAN
JCSG Internal annotations

ACCESSIONYP_001635819.1
DESCRIPTIONTetR transcriptional regulator
ORGANISMChloroflexus aurantiacus j-10-fl
COMMENT 
DR UNIPROT; Q3DXK6_CHLAU
DR SPTR;
DR GenBank;
DR Pfam; PF00440; TetR_N;
DR PDB; 3QBM; Identical; 02-FEB-11; TETR TRANSCRIPTIONAL REGULATOR;
DR PDB; 3EUP; Highly similar; 25-NOV-08; TRANSCRIPTIONAL REGULATOR, TETR FAMILY;
DR PDB; 3VPR; Highly similar; 11-JUL-12; TRANSCRIPTIONAL REGULATOR, TETR FAMILY;
DR FFAS; 399264; Fold and function assignment.
DR TVPC; YP_001635819.1; Homologs in PDB, JCSG and SG center.
DR OVP; YP_001635819.1; Ortholog view popup.
DR TPM; YP_001635819.1; Target PDB monitor.
DR FSS; YP_001635819.1; Target function coverage.
PROPERTY Residues: 198 aa
Molecule Weight: 21864.87 Dalton
Isoelectric Point: 5.98
Extinction Coefficient: 14440
Gravy Index: -.01
Number of Met residues: 5
Percentage of Met residues: 2.53 %
Number of Cys residues: 1
Percentage of Cys residues: 0.51 %
SEQUENCE  amino acids 198 aa
>YP_001635819.1  caur_25may01_Contig941_revised_gene4220
MRKGQETRERVVAQAAALFNVSGYAGTAISDIMAATGLEKGGIYRHFESKEQLALAAFDY
AAEKVRERFAVGLAGHKHTVDTIIAFLDVFRSYAERPPLVGGCPILNTAIESDDTNPMLR
ERVRAVIDEWRETIRTLVQTGIARGEIRPEVDADRLALLIIATMEGAVMLARILETATPL
EHAYTHLATYITQQVRLA

CDS  cDNA 597 bp
   1 atgcggaagg ggcaggagac ccgcgagcgg gtcgtggcac aggcggcggc gcttttcaat    60
  61 gtttcaggct atgccggcac cgcgatcagt gacattatgg cagcgacggg gctggagaaa   120
 121 ggagggatct accggcattt cgagagtaaa gagcagcttg cgctggctgc gtttgactat   180
 181 gctgctgaga aagtccgtga gcggttcgca gttggtctgg cagggcacaa gcacacagtg   240
 241 gatacgatca tcgcttttct ggatgtcttt cgtagttacg ctgaacgtcc accgctggtc   300
 301 ggcggctgcc cgatactcaa cactgccatc gagagcgatg ataccaaccc gatgttacgt   360
 361 gagcgggtac gtgccgttat tgacgagtgg cgcgagacca tccgaacgct ggtacagacc   420
 421 ggtattgccc gtggcgagat tcgcccggag gttgacgctg accggctggc actgctcatc   480
 481 attgcgacga tggaaggagc agtgatgctt gcccgtattc tggaaaccgc cacgccctta   540
 541 gaacatgcat atacacatct tgccacctat atcacgcagc aggtgcggtt ggcctga   597
Target constructs
Download sequence in PIR or FASTA format
Chemical properties of sequence with tag

Notes

The start codon is a ATG/Methionine in most of sequences, but the GTG/V, TTG/L, CTG/I can be the start codons in some cases as expressing in E.coli. The start codon warning is labelled by RED color in sequence(sample: 10174951).

Protein sequence information contains the annotation contents from both of JCSG and SWISS-PROT. The SWISS-PROT/TrEMBL annotation is accessed from SWALL(SPTR) on the EBI SRS server. PDB homologes show both identical and highly similar proteins with released date and protein function.


Contact Webmaster JCSG Menu