LOADING...
   YP_001337186.1;SP18632A
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
YP_001337186.1    SP18632A            JCSG 418474 PDB Deposition 14-MAR-21              PDB id: 4pwu

Protein Sequence Information


TOPSAN
JCSG Internal annotations

ACCESSIONYP_001337186.1
DESCRIPTIONCASP Target
Description Hidden
ORGANISMKlebsiella pneumoniae subsp. pneumoniae mgh 78578
COMMENT 
DR UNIPROT;
DR SPTR;
DR GenBank;
DR PDB; 4PWU; Identical; 18-JUN-14; MODULATOR PROTEIN MZRA;
DR FFAS; 411741; Fold and function assignment.
DR TVPC; YP_001337186.1; Homologs in PDB, JCSG and SG center.
DR OVP; YP_001337186.1; Ortholog view popup.
DR TPM; YP_001337186.1; Target PDB monitor.
DR FSS; YP_001337186.1; Target function coverage.
PROPERTY Residues: 128 aa
Molecule Weight: 14126.69 Dalton
Isoelectric Point: 9.69
Extinction Coefficient: 28990
Gravy Index: .06
Number of Met residues: 4
Percentage of Met residues: 3.12 %
Number of Cys residues: 0
Percentage of Cys residues: 0.00 %
SEQUENCE  amino acids 128 aa
>YP_001337186.1  gi|152972040|ref|YP_001337186.1| hypothetical protein KPN_03524 [Klebsiella pneumoniae subsp. pneumo
MMVMKRPSLRQFSWLLGGSLLLGALFWLWLAVQQQEATLAIRPVGQGIGMPDGFSVWHHL
DANGIRFKSITPQKDGLLIKFDSTAQGAAAKEVLGRALPHGYIIALLEDDNSPTAWLSRL
RDAPHRLG

CDS  cDNA 387 bp
   1 atgatggtca tgaaacgccc ttccctgcgc cagttcagct ggctgctggg tggttctctt    60
  61 ctgctcggcg ccctgttctg gctttggctg gcggtgcagc agcaggaggc cacgctggcg   120
 121 atacgcccgg ttggccaggg tatcggaatg ccggacggtt tctccgtctg gcatcatctc   180
 181 gatgccaacg gcatccgctt taaaagcatc acgccgcaga aggatggtct gctgattaag   240
 241 ttcgattcca ccgcccaggg cgcggcggcg aaagaagttc tcggccgcgc tctgccacat   300
 301 ggttatatta ttgcccttct ggaggacgat aactcgccca ccgcctggct atcccgcctg   360
 361 cgcgacgcgc cgcatcgcct cgggtaa   387
Target constructs
Download sequence in PIR or FASTA format
Chemical properties of sequence with tag

Notes

The start codon is a ATG/Methionine in most of sequences, but the GTG/V, TTG/L, CTG/I can be the start codons in some cases as expressing in E.coli. The start codon warning is labelled by RED color in sequence(sample: 10174951).

Protein sequence information contains the annotation contents from both of JCSG and SWISS-PROT. The SWISS-PROT/TrEMBL annotation is accessed from SWALL(SPTR) on the EBI SRS server. PDB homologes show both identical and highly similar proteins with released date and protein function.


Contact Webmaster JCSG Menu