LOADING...
   YP_001337146.1;SP18574A
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
YP_001337146.1    SP18574A            JCSG 418471 PDB Deposition 15-JAN-28              PDB id: 4xvv

Protein Sequence Information


TOPSAN
JCSG Internal annotations

ACCESSIONYP_001337146.1
DESCRIPTIONCASP Target
Description Hidden
ORGANISMKlebsiella pneumoniae subsp. pneumoniae mgh 78578
COMMENT 
DR UNIPROT;
DR SPTR;
DR GenBank;
DR PDB; 4XVV; Identical; 11-FEB-15; ACID STRESS CHAPERONE HDEB;
DR PDB; 2XUV; Highly similar; 24-AUG-11; HDEB;
DR PDB; 2MYJ; Highly similar; 06-JAN-16; ACID STRESS CHAPERONE HDEB;
DR FFAS; 411737; Fold and function assignment.
DR TVPC; YP_001337146.1; Homologs in PDB, JCSG and SG center.
DR OVP; YP_001337146.1; Ortholog view popup.
DR TPM; YP_001337146.1; Target PDB monitor.
DR FSS; YP_001337146.1; Target function coverage.
PROPERTY Residues: 101 aa
Molecule Weight: 11196.41 Dalton
Isoelectric Point: 5.19
Extinction Coefficient: 12490
Gravy Index: -.06
Number of Met residues: 7
Percentage of Met residues: 6.93 %
Number of Cys residues: 3
Percentage of Cys residues: 2.97 %
SEQUENCE  amino acids 101 aa
>YP_001337146.1  gi|152972000|ref|YP_001337146.1| hypothetical protein KPN_03484 [Klebsiella pneumoniae subsp. pneumo
MNLPKALVLTVAATTFCLMTSPAFAVEETTPQNMTCQEFMDMNPKSMTPVAFWVVNRNTD
FSGGDYVDWHEVETVSVPKMLQECHKNPAAKLGDLSAVIKK

CDS  cDNA 306 bp
   1 atgaatttac ctaaagcact cgtattgacc gtggcggcta ccacattctg tctgatgacc    60
  61 agcccggcgt tcgcggttga ggaaaccacg ccgcagaata tgacctgtca ggaatttatg   120
 121 gatatgaacc caaaaagcat gaccccggtg gccttctggg tagtgaatcg caacaccgac   180
 181 tttagcggcg gcgactatgt tgactggcat gaagttgaga ccgtttcggt accgaaaatg   240
 241 ctgcaggagt gccacaagaa ccccgcagct aaacttggcg atctcagcgc ggtcatcaaa   300
 301 aaataa   306
Target constructs
Download sequence in PIR or FASTA format
Chemical properties of sequence with tag

Notes

The start codon is a ATG/Methionine in most of sequences, but the GTG/V, TTG/L, CTG/I can be the start codons in some cases as expressing in E.coli. The start codon warning is labelled by RED color in sequence(sample: 10174951).

Protein sequence information contains the annotation contents from both of JCSG and SWISS-PROT. The SWISS-PROT/TrEMBL annotation is accessed from SWALL(SPTR) on the EBI SRS server. PDB homologes show both identical and highly similar proteins with released date and protein function.


Contact Webmaster JCSG Menu