LOADING...
   YP_001336791.1;SP18483B
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
YP_001336791.1    SP18483B            JCSG 420277 PDB Deposition 15-JUN-29              PDB id: 5cai

Protein Sequence Information


TOPSAN
JCSG Internal annotations

ACCESSIONYP_001336791.1
DESCRIPTIONCASP Target
Description Hidden
ORGANISMKlebsiella pneumoniae subsp. pneumoniae mgh 78578
COMMENT 
DR UNIPROT;
DR SPTR;
DR GenBank;
DR Pfam; PF06004; DUF903;
DR PDB; 2RA2; Highly similar; 09-OCT-07; PUTATIVE LIPOPROTEIN;
DR PDB; 3BDU; Highly similar; 27-NOV-07; PUTATIVE LIPOPROTEIN;
DR PDB; 2JN0; Highly similar; 01-MAY-07; HYPOTHETICAL LIPOPROTEIN YGDR;
DR PDB; 3FIF; Highly similar; 06-JAN-09; UNCHARACTERIZED LIPOPROTEIN YGDR;
DR PDB; 2RD1; Highly similar; 09-OCT-07; PUTATIVE OUTER MEMBRANE LIPOPROTEIN;
DR PDB; 2RB6; Highly similar; 23-OCT-07; UNCHARACTERIZED PROTEIN;
DR FFAS; 411663; Fold and function assignment.
DR TVPC; YP_001336791.1; Homologs in PDB, JCSG and SG center.
DR OVP; YP_001336791.1; Ortholog view popup.
DR TPM; YP_001336791.1; Target PDB monitor.
DR FSS; YP_001336791.1; Target function coverage.
PROPERTY Residues: 76 aa
Molecule Weight: 8282.94 Dalton
Isoelectric Point: 5.68
Extinction Coefficient: 8480
Gravy Index: -.48
Number of Met residues: 5
Percentage of Met residues: 6.58 %
Number of Cys residues: 2
Percentage of Cys residues: 2.63 %
SEQUENCE  amino acids 76 aa
>YP_001336791.1  gi|152971682|ref|YP_001336791.1| hypothetical protein KPN_03160 [Klebsiella pneumoniae subsp. pneumo
MKMTKAAAIISACMLTLGLSACSSNYVMHTNDGRTIVTDGKPQTDNDTGMISYKDAWGNK
QQINRSDVKQLGELDE

CDS  cDNA 231 bp
   1 atgaaaatga ctaaggccgc tgcgattatc tctgcctgta tgctgacttt aggcctgagc    60
  61 gcctgttcct ctaactatgt gatgcatacc aacgatgggc ggaccatcgt taccgacggg   120
 121 aaaccgcaaa ccgataatga cactggcatg atctcgtata aagacgcgtg gggcaacaaa   180
 181 cagcagatca atcgctctga cgtgaaacaa ctgggtgaac tggacgagta a   231
Target constructs
Download sequence in PIR or FASTA format
Chemical properties of sequence with tag

Notes

The start codon is a ATG/Methionine in most of sequences, but the GTG/V, TTG/L, CTG/I can be the start codons in some cases as expressing in E.coli. The start codon warning is labelled by RED color in sequence(sample: 10174951).

Protein sequence information contains the annotation contents from both of JCSG and SWISS-PROT. The SWISS-PROT/TrEMBL annotation is accessed from SWALL(SPTR) on the EBI SRS server. PDB homologes show both identical and highly similar proteins with released date and protein function.


Contact Webmaster JCSG Menu