LOADING...
   YP_001335469.1;SP5895B
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
YP_001335469.1    SP5895B            JCSG 420280 PDB Deposition 15-MAY-27              PDB id: 5bov

Protein Sequence Information


TOPSAN
JCSG Internal annotations

ACCESSIONYP_001335469.1
DESCRIPTIONCASP Target
Description Hidden
ORGANISMKlebsiella pneumoniae subsp. pneumoniae mgh 78578
COMMENT 
DR UNIPROT;
DR SPTR;
DR GenBank;
DR Pfam; PF00561; Abhydrolase_1;
DR PDB; 4NVR; Highly similar; 18-DEC-13; PUTATIVE ACYLTRANSFERASE;
DR FFAS; 411697; Fold and function assignment.
DR TVPC; YP_001335469.1; Homologs in PDB, JCSG and SG center.
DR OVP; YP_001335469.1; Ortholog view popup.
DR TPM; YP_001335469.1; Target PDB monitor.
DR FSS; YP_001335469.1; Target function coverage.
PROPERTY Residues: 338 aa
Molecule Weight: 37151.01 Dalton
Isoelectric Point: 8.48
Extinction Coefficient: 73340
Gravy Index: -.26
Number of Met residues: 4
Percentage of Met residues: 1.18 %
Number of Cys residues: 1
Percentage of Cys residues: 0.30 %
SEQUENCE  amino acids 338 aa
>YP_001335469.1  gi|152970360|ref|YP_001335469.1| putative epoxide hydrolase protein [Klebsiella pneumoniae subsp. pn
MTIKGEKTMNRLSLIRYTSAVALGLSTLWSAAVCAAEDAGAFDKIQQIRAGDLNIGYVDI
GPRDGQPVILLHGWPYDIQSYAQVAPALAQKGYRVIVPYLRGYGTTRFLSASTPRNGQPS
AMAADIVHLMDALNIRQADLAGFDWGARTADIVAALWPQRVKSLVSVSGYLISSQQIGEK
PLPPQAELSWWYQFYFATPRGEAGYRQNTHDFAKFIWHQASPQWQFSDATFAKTARALDN
PDHVAITISNYRWRLGLEKGEAKYAGYEQRLAALPPITVPTITLEGANNGAPHPAPASYR
AKFTGKYEHRDLPGAVGHNPPQEDPTAFVQAVVDADRL

CDS  cDNA 1017 bp
   1 atgacgataa aaggtgagaa aacgatgaac agattatccc tgatccgcta taccagcgcc    60
  61 gtggcgctgg ggttatccac cctgtggtcc gccgccgttt gcgccgctga agacgcgggg   120
 121 gcgttcgaca agatccagca gatccgcgcc ggcgacctga atattggcta cgtggatatc   180
 181 ggcccacgcg acggccagcc ggtgatcctg ctgcacggct ggccctacga cattcagagc   240
 241 tatgcccagg tggcgccggc tctagcgcag aagggttacc gggtgatcgt gccgtatctg   300
 301 cgtggctacg gcactacccg tttcctctcc gccagcacgc cgcgtaacgg tcagccgtcg   360
 361 gcgatggcgg ccgatattgt ccatctgatg gacgccctta acatcaggca ggcggatctg   420
 421 gccggttttg actggggcgc gcgcacggcg gatatcgtcg ccgcgctgtg gccgcagcgg   480
 481 gtgaaatccc tggtctcggt gagcgggtat ctgatcagca gtcagcagat tggcgaaaaa   540
 541 ccgctgccac cgcaggctga gctgtcgtgg tggtatcaat tctattttgc cactccgcgt   600
 601 ggggaggccg gttaccggca aaacacccac gactttgcga aatttatctg gcatcaggcg   660
 661 tcgccgcagt ggcaattcag cgacgcgacc tttgccaaaa ccgcccgggc tctggataac   720
 721 ccggaccatg tggcgatcac catcagcaac taccgctggc gcctggggct ggagaaaggg   780
 781 gaagcgaagt atgccggcta tgaacaacgg ctggcggcgc taccgccgat aaccgtgccc   840
 841 accatcaccc tggaaggggc gaataacggc gcgccgcatc cggctcccgc cagctaccgt   900
 901 gccaaattta ccggtaaata tgagcaccgg gatctgccgg gagcggtggg ccataacccg   960
 961 ccgcaggagg atccgacggc gtttgtgcag gcggtggtgg acgccgatcg tttgtaa  1017
Target constructs
Download sequence in PIR or FASTA format
Chemical properties of sequence with tag

Notes

The start codon is a ATG/Methionine in most of sequences, but the GTG/V, TTG/L, CTG/I can be the start codons in some cases as expressing in E.coli. The start codon warning is labelled by RED color in sequence(sample: 10174951).

Protein sequence information contains the annotation contents from both of JCSG and SWISS-PROT. The SWISS-PROT/TrEMBL annotation is accessed from SWALL(SPTR) on the EBI SRS server. PDB homologes show both identical and highly similar proteins with released date and protein function.


Contact Webmaster JCSG Menu