LOADING...
   YP_001305260.1;PX14343H
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
YP_001305260.1    PX14343H            JCSG 396627 PDB Deposition 10-SEP-13              PDB id: 3otn

Protein Sequence Information


TOPSAN
JCSG Internal annotations

ACCESSIONYP_001305260.1
DESCRIPTIONSusD superfamily protein. Putative outer membrane protein, probably involved in nutrient binding.
ORGANISMParabacteroides distasonis atcc 8503
COMMENT-----------------------------------------------------------------------
Copyrighted by the UniProt Consortium, see http://www.uniprot.org/terms
Distributed under the Creative Commons Attribution-NoDerivs License
-----------------------------------------------------------------------
DR UNIPROT; A6LIX4_PARD8
DR SPTR; A6LIX4 (flat text); A6LIX4 (good view)
DR GenBank; YP_001305260
DR Pfam; PF07980; SusD;
DR PDB; 3OTN; Identical; 03-NOV-10; SUSD SUPERFAMILY PROTEIN;
DR FFAS; 396103; Fold and function assignment.
DR TVPC; YP_001305260.1; Homologs in PDB, JCSG and SG center.
DR OVP; YP_001305260.1; Ortholog view popup.
DR TPM; YP_001305260.1; Target PDB monitor.
DR FSS; YP_001305260.1; Target function coverage.
PROPERTY Residues: 506 aa
Molecule Weight: 58019.38 Dalton
Isoelectric Point: 4.97
Extinction Coefficient: 90650
Gravy Index: -.39
Number of Met residues: 11
Percentage of Met residues: 2.17 %
Number of Cys residues: 6
Percentage of Cys residues: 1.19 %
SEQUENCE  amino acids 506 aa
>YP_001305260.1  gi|150010517|ref|YP_001305260.1| putative outer membrane protein, probably involved in nutrient bind
MKINKIYIVSLCALFLSSCNNFLDEQPTGTMTTDSKLTSKESALALTNSAYLKNTVFNKM
TPGWGCNTILLLEYMTGKATSENSQSNYKDFQDLLVSDRSLYIEDWWQDCYAGIANCNLA
LQKLGEFENLDASLVNGYMAEVKFMRALYYFYLVRIFGDVPKITTVQSELGELQVSRAPV
KEIYDEIIIPDLLEAEQSDLAFSDHTGRVSMGAVKALLADVYLTYAGYPLQGGKSYYAES
AKRSLEVIKSNEYTLFTDYESLRLPSQNNKGEFIYQVQFSLNKRHNESVRIFLPSRSGIS
AYDLEYGSLIPTKEFVESFEKGDKRTEEKQYFFTNYKGHPSKFSPGAAELEFMDLNGYYI
YKFFDQVAVDNTAKSDLNWSVYRYTDVLLMYAEAQVNADGTPNQQSIDIVNQIRGRAGLA
PFKQTNASAFLEEVWDQRYFDLCYENKMWFDMLRTRKIRDDKSGEYVDFIGYKTNWGKVY
TETQLLFPIPLSERQANPNLTQNQGY

CDS  cDNA 1521 bp
   1 atgaaaataa ataaaatcta tatcgtctca ttatgtgcgt tattcttgtc ttcttgtaat    60
  61 aatttcttgg acgagcagcc taccggtacg atgactaccg attcaaagtt gacaagtaag   120
 121 gagtccgctt tggccttgac gaattcggct tatttgaaga atacggtctt taataagatg   180
 181 accccgggtt ggggatgtaa tacgatctta ttgctcgaat atatgactgg caaagctact   240
 241 tccgagaatt cccaatcgaa ttataaggac tttcaggatc tactggtgag tgatcgttct   300
 301 ttatatatcg aggactggtg gcaagattgt tatgcaggta tagcgaactg taacctcgcg   360
 361 cttcaaaaac tcggggagtt cgagaatctg gatgcttcct tggttaatgg ctacatggcc   420
 421 gaggtgaagt ttatgagggc tttgtattat ttctatttgg tacgtatctt tggcgatgtc   480
 481 cctaagatta cgaccgtaca gtcggagttg ggagagctgc aagtatctcg tgccccggta   540
 541 aaggaaatct atgatgagat cattattccg gatttgttgg aggccgagca atcggatctg   600
 601 gcttttagcg atcatacagg gcgtgtctcg atgggagcgg tgaaagcgct tcttgcggat   660
 661 gtctatctta cgtatgccgg ttatcctttg caaggaggta aatcttatta cgcggaatcg   720
 721 gctaaacgtt cattggaggt tataaaatcg aatgagtata cgctcttcac ggattatgag   780
 781 agcctacggc ttccgtcgca gaataataag ggagagttta tttatcaagt tcagttctcc   840
 841 ttgaacaagc ggcataacga gtcggtacgt atctttttac cttctcgttc cggcatttcc   900
 901 gcctacgatt tggaatatgg tagcctgatc cctaccaagg agttcgtgga aagctttgag   960
 961 aaaggagata agcgtacgga agagaagcaa tatttcttta cgaactacaa ggggcatccg  1020
1021 agtaagttct ctccgggagc ggcagagttg gagtttatgg atttgaatgg ctattatatc  1080
1081 tataagtttt ttgatcaagt agctgttgat aatacggcga agtcggactt gaactggagt  1140
1141 gtatatcgtt acacggatgt attattaatg tatgcggaag cgcaagtgaa tgcggatggt  1200
1201 actccgaacc agcaatccat cgatattgtg aaccaaatac gaggaagggc cggattagcg  1260
1261 ccgttcaagc agaccaacgc aagcgcattc ttggaggaag tctgggacca acgttacttt  1320
1321 gacctatgtt atgagaataa gatgtggttt gatatgctac gcacccgtaa gatccgggat  1380
1381 gataaatccg gggaatatgt ggactttatc ggctataaga cgaattgggg taaggtgtat  1440
1441 acggaaaccc agctattgtt cccgattcca ttaagcgaac ggcaggcgaa tccgaacctg  1500
1501 actcagaatc aaggttatta a  1521
Target constructs
Download sequence in PIR or FASTA format
Chemical properties of sequence with tag

Notes

The start codon is a ATG/Methionine in most of sequences, but the GTG/V, TTG/L, CTG/I can be the start codons in some cases as expressing in E.coli. The start codon warning is labelled by RED color in sequence(sample: 10174951).

Protein sequence information contains the annotation contents from both of JCSG and SWISS-PROT. The SWISS-PROT/TrEMBL annotation is accessed from SWALL(SPTR) on the EBI SRS server. PDB homologes show both identical and highly similar proteins with released date and protein function.


Contact Webmaster JCSG Menu