LOADING...
   YP_001305217.1;GS13654A
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
YP_001305217.1    GS13654A            JCSG 394763 PDB Deposition 14-MAY-30              PDB id: 4qhz

Protein Sequence Information


TOPSAN
JCSG Internal annotations

ACCESSIONYP_001305217.1
DESCRIPTIONCASP Target
Description Hidden
ORGANISMParabacteroides distasonis atcc 8503
COMMENT 
DR UNIPROT; A6LIT1_PARD8
DR SPTR; A6LIT1 (flat text); A6LIT1 (good view)
DR GenBank; YP_001305217
DR Pfam; PF06439; DUF1080;
DR PDB; 4QHZ; Identical; 30-JUL-14; PUTATIVE GLYCOSYL HYDROLASE;
DR FFAS; 384078; Fold and function assignment.
DR TVPC; YP_001305217.1; Homologs in PDB, JCSG and SG center.
DR OVP; YP_001305217.1; Ortholog view popup.
DR TPM; YP_001305217.1; Target PDB monitor.
DR FSS; YP_001305217.1; Target function coverage.
PROPERTY Residues: 265 aa
Molecule Weight: 29295.8 Dalton
Isoelectric Point: 6.17
Extinction Coefficient: 46410
Gravy Index: -.33
Number of Met residues: 6
Percentage of Met residues: 2.26 %
Number of Cys residues: 2
Percentage of Cys residues: 0.75 %
SEQUENCE  amino acids 265 aa
>YP_001305217.1  gi|150010474|ref|YP_001305217.1| conserved hypothetical protein, with a domain of unknown function [
MNKRLLTVAAFALAGCVTVVAQDKKKEFKMPTGYAGITHEMSEFYEPVPPVVTPGTDLKG
GGFTAPSDAIVLFDGKDLSAWESVKGGAAEWDVHDGVFTVNKKKGDIQTKQKFNDFQMHI
EWQVPTNITGESQSRGNSGIFLQGMYEVQVLDCYNNPTYVNGQTGSIYKQSIPLANAMRK
PGEWNVYDIIYTAPTFKEDGSYRTHPTVTVIQNGVVLQNHTTILGTTEWIGFPQVKKHGA
GPIILQSHGDPSEPISFRNIWIREL

CDS  cDNA 798 bp
   1 atgaacaaaa gattgcttac agttgcggct ttcgctttag cgggttgcgt taccgttgtc    60
  61 gctcaagaca agaaaaaaga gttcaagatg cctacaggtt atgcgggtat cacgcatgag   120
 121 atgtccgagt tttacgaacc tgttccgccg gtagtcactc cgggtacaga tttaaaaggt   180
 181 ggaggtttca cggctccttc cgacgctatc gttttgtttg acggcaagga tctttccgct   240
 241 tgggagagcg taaagggcgg tgccgccgaa tgggatgtgc atgatggtgt atttaccgta   300
 301 aacaagaaga agggtgatat ccagaccaaa cagaaattca acgatttcca gatgcatatc   360
 361 gaatggcaag tcccgacgaa tatcacagga gagagccagt cgagaggcaa cagcggtatt   420
 421 ttcctacaag ggatgtatga ggttcaagtg ttagactgct acaataaccc gacttacgtg   480
 481 aacggccaga ctggtagtat ctacaaacaa tccattcctt tggccaatgc catgcgtaaa   540
 541 ccgggcgaat ggaacgtata cgatatcatt tataccgccc ccactttcaa ggaagatggt   600
 601 tcttatcgca cgcatccaac cgtaacggtt atccagaacg gcgtggtttt gcagaaccat   660
 661 acgacgatat tgggtacgac agagtggatc ggtttcccgc aagtgaagaa acatggcgca   720
 721 ggccctatca tcctgcagag ccatggcgat cctagcgagc cgatcagctt ccgtaatatc   780
 781 tggattcgtg agctatag   798
Target constructs
Download sequence in PIR or FASTA format
Chemical properties of sequence with tag

Notes

The start codon is a ATG/Methionine in most of sequences, but the GTG/V, TTG/L, CTG/I can be the start codons in some cases as expressing in E.coli. The start codon warning is labelled by RED color in sequence(sample: 10174951).

Protein sequence information contains the annotation contents from both of JCSG and SWISS-PROT. The SWISS-PROT/TrEMBL annotation is accessed from SWALL(SPTR) on the EBI SRS server. PDB homologes show both identical and highly similar proteins with released date and protein function.


Contact Webmaster JCSG Menu