LOADING...
   YP_001304549.1;SP13991A
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
YP_001304549.1    SP13991A            JCSG 418938 PDB Deposition 14-JUL-29              PDB id: 4r03

Protein Sequence Information


TOPSAN
JCSG Internal annotations

ACCESSIONYP_001304549.1
DESCRIPTIONCASP Target
Description Hidden
ORGANISMParabacteroides distasonis atcc 8503
COMMENT 
DR UNIPROT;
DR SPTR;
DR GenBank;
DR PDB; 4R03; Identical; 27-AUG-14; UNCHARACTERIZED PROTEIN;
DR FFAS; 412657; Fold and function assignment.
DR TVPC; YP_001304549.1; Homologs in PDB, JCSG and SG center.
DR OVP; YP_001304549.1; Ortholog view popup.
DR TPM; YP_001304549.1; Target PDB monitor.
DR FSS; YP_001304549.1; Target function coverage.
PROPERTY Residues: 136 aa
Molecule Weight: 16047.44 Dalton
Isoelectric Point: 7.71
Extinction Coefficient: 35410
Gravy Index: -.62
Number of Met residues: 4
Percentage of Met residues: 2.94 %
Number of Cys residues: 1
Percentage of Cys residues: 0.74 %
SEQUENCE  amino acids 136 aa
>YP_001304549.1  gi|150009806|ref|YP_001304549.1| hypothetical protein BDI_3222 [Parabacteroides distasonis ATCC 8503
MKTSVWGKSILALVFTFMCSLAISAASPKDYLYDTKEENGKIISKVVFLQENGLLNKQVR
YEFQYNENGKVSEKKAFRWDRTNDEWVPFYQITYQYDDQSGEIKTNYGMWDKKKKNFSLN
VQNMIIPSTNYEEIFS

CDS  cDNA 411 bp
   1 atgaagacat cagtttgggg taaaagtatt cttgcgcttg tttttacttt catgtgtagt    60
  61 ttagcgataa gcgcagcgtc tcctaaagat tatctatatg atacaaaaga ggagaatggt   120
 121 aagattatct ctaaagtggt attcttacag gaaaacggac tgttgaacaa acaggtaaga   180
 181 tatgagttcc agtacaacga gaacggcaag gtttccgaga agaaagcgtt tcgttgggat   240
 241 cggacaaacg atgaatgggt tccattctat cagatcactt atcaatatga tgatcaaagt   300
 301 ggagagataa agacaaatta cggtatgtgg gataagaaaa agaaaaactt tagcttaaat   360
 361 gtccagaaca tgattatccc gagtactaat tacgaagaaa ttttctcata a   411
Target constructs
Download sequence in PIR or FASTA format
Chemical properties of sequence with tag

Notes

The start codon is a ATG/Methionine in most of sequences, but the GTG/V, TTG/L, CTG/I can be the start codons in some cases as expressing in E.coli. The start codon warning is labelled by RED color in sequence(sample: 10174951).

Protein sequence information contains the annotation contents from both of JCSG and SWISS-PROT. The SWISS-PROT/TrEMBL annotation is accessed from SWALL(SPTR) on the EBI SRS server. PDB homologes show both identical and highly similar proteins with released date and protein function.


Contact Webmaster JCSG Menu