LOADING...
   YP_001304276.1;SP16569N
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
YP_001304276.1    SP16569N            JCSG 419091 PDB Deposition 12-JUN-11              PDB id: 4fj6

Protein Sequence Information


TOPSAN
JCSG Internal annotations

ACCESSIONYP_001304276.1
DESCRIPTIONGlycoside hydrolase family 33, candidate sialidase, bacterial neuraminidase repeat, intramolecular
trans-sialidase, a carbohydrate binding domain
ORGANISMParabacteroides distasonis atcc 8503
COMMENT 
DR UNIPROT;
DR SPTR;
DR GenBank;
DR PDB; 4FJ6; Identical; 25-JUL-12; GLYCOSIDE HYDROLASE FAMILY 33, CANDIDATE SIALIDAS CHAIN: A,;
DR PDB; 4Q6K; Highly similar; 01-OCT-14; BNR/ASP-BOX REPEAT PROTEIN;
DR PDB; 4BBW; Highly similar; 14-AUG-13; SIALIDASE (NEURAMINIDASE);
DR PDB; 1EUT; Highly similar; 11-JAN-97; SIALIDASE;
DR PDB; 1EUU; Highly similar; 11-JAN-97; SIALIDASE;
DR PDB; 1EUR; Highly similar; 11-JAN-97; SIALIDASE;
DR PDB; 1EUS; Highly similar; 11-JAN-97; SIALIDASE;
DR PDB; 1WCQ; Highly similar; 12-OCT-05; SIALIDASE;
DR FFAS; 412664; Fold and function assignment.
DR TVPC; YP_001304276.1; Homologs in PDB, JCSG and SG center.
DR OVP; YP_001304276.1; Ortholog view popup.
DR TPM; YP_001304276.1; Target PDB monitor.
DR FSS; YP_001304276.1; Target function coverage.
PROPERTY Residues: 541 aa
Molecule Weight: 60187.46 Dalton
Isoelectric Point: 6.33
Extinction Coefficient: 90870
Gravy Index: -.31
Number of Met residues: 18
Percentage of Met residues: 3.33 %
Number of Cys residues: 3
Percentage of Cys residues: 0.55 %
SEQUENCE  amino acids 541 aa
>YP_001304276.1  gi|150009533|ref|YP_001304276.1| glycoside hydrolase family 33, candidate sialidase [Parabacteroides
MKKTFLYFCLLFIVQTAFAADSIYVREQQIPILIDRIDNVLYEMRIPAQKGDVLNEITIQ
IGDNVDLSDIQAIRLFYSGVEAPSRKGEHFSPVTYISSHIPGNTRKALESYSVRQDEVTA
PLSRTVKLTSKQPMLKGINYFWVSIQMKPETSLLAKVATTMPNAQINNKPINITWKGKVD
ERHVGIGVRQAGDDGSAAFRIPGLVTTNNGTLLGVYDIRYNSSVDLQEKIDIGVSRSTDK
GQTWEPMRVAMTFKQTDGLPHGQNGVGDPSILVDEKTNTIWVVAAWTHGMGNERAWWNSM
PGMTPDETAQLMLVKSEDDGKTWSEPINITSQVKDPSWYFLLQGPGRGITMQDGTLVFPI
QFIDATRVPNAGIMYSKDRGKTWHLHNLARTNTTEAQVAEVEPGVLMLNMRDNRGGSRAV
ATTKDLGKTWTEHPSSRSALQESVCMASLIKVNAKDNITGKDLLLFSNPNTTKGRNHITI
KASLDGGLTWPTEHQVLLDEAEGWGYSCLSMIDKETVGIFYESSVAHMTFQAVKLQDLIH
Q

CDS  cDNA 1626 bp
   1 atgaaaaaaa ctttcctgta tttctgcctt cttttcatcg tacaaacggc ttttgcggca    60
  61 gacagtattt atgtgcgaga gcaacaaatc cccatcttga tagaccggat cgacaatgta   120
 121 ctttacgaga tgcggatacc ggcccaaaaa ggggatgtat taaacgagat cacgatacag   180
 181 atcggagaca atgtcgacct gtcggacatc caagcgatac gtctatttta tagcggagtg   240
 241 gaagctcctt cccgcaaagg ggaacatttc agtcccgtta cgtacatatc cagccatata   300
 301 ccgggaaata cccgtaaggc tcttgaatct tattccgtac ggcaagatga ggttaccgcc   360
 361 cccttgtcgc gcacggtaaa actaacctct aagcaaccga tgcttaaagg catcaactat   420
 421 ttctgggtaa gtatccagat gaagcctgag acttccttat tggcaaaagt agcgaccacg   480
 481 atgcctaacg cccagatcaa caacaaaccg atcaacatca cttggaaagg aaaggtggac   540
 541 gaacgccatg taggtatcgg cgtacgccaa gccggggatg acggatcggc ggccttccgc   600
 601 atcccgggat tagtgacgac gaataacgga acattactcg gagtctacga tattcgctat   660
 661 aatagcagcg tggacctgca agagaaaatc gatatcggag taagccgcag taccgataag   720
 721 ggacaaactt gggaaccgat gcgagtagcc atgactttca aacaaacgga tggcctgccc   780
 781 cacggacaaa acggcgtggg agacccatcg atcttggtag acgaaaagac caatacgatc   840
 841 tgggtagtag ccgcatggac gcatggtatg ggtaacgaac gggcttggtg gaactccatg   900
 901 ccgggaatga caccggacga gaccgcccaa cttatgctcg tgaaaagtga ggacgatggt   960
 961 aagacgtgga gcgaaccgat caacatcacg tctcaagtaa aagacccgtc ttggtatttc  1020
1021 ttattgcaag gcccgggacg aggcatcacg atgcaagacg gtactttggt cttccccatc  1080
1081 cagtttatcg acgctacccg tgtgccgaac gccggtatca tgtatagcaa agaccgaggg  1140
1141 aaaacatggc atctacacaa cttggcccgc acgaatacca ccgaggcgca agttgccgag  1200
1201 gtagaaccgg gcgtattgat gctaaatatg cgcgataacc gaggcggtag ccgtgccgta  1260
1261 gccactacaa aggatttagg caagacatgg acggagcatc cttccagccg tagcgcctta  1320
1321 caggaatccg tttgtatggc cagcttgatc aaggtaaacg ccaaggataa catcaccggc  1380
1381 aaggaccttc tactcttctc caacccgaac acgacgaaag ggcgtaatca tatcacgatc  1440
1441 aaggcgagtc tggacggtgg acttacttgg cccacggagc atcaagtctt attagacgag  1500
1501 gccgaggggt ggggatattc ctgtctttcg atgatcgata aggaaacggt aggaatcttc  1560
1561 tacgagtcaa gcgtagcgca tatgaccttc caagctgtca aattacagga tctcattcat  1620
1621 caataa  1626
Target constructs
Download sequence in PIR or FASTA format
Chemical properties of sequence with tag

Notes

The start codon is a ATG/Methionine in most of sequences, but the GTG/V, TTG/L, CTG/I can be the start codons in some cases as expressing in E.coli. The start codon warning is labelled by RED color in sequence(sample: 10174951).

Protein sequence information contains the annotation contents from both of JCSG and SWISS-PROT. The SWISS-PROT/TrEMBL annotation is accessed from SWALL(SPTR) on the EBI SRS server. PDB homologes show both identical and highly similar proteins with released date and protein function.


Contact Webmaster JCSG Menu