LOADING...
   YP_001303066.1;GS13232A
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
YP_001303066.1    GS13232A            JCSG 385916 PDB Deposition 13-DEC-17              PDB id: 4o2t

Protein Sequence Information


TOPSAN
JCSG Internal annotations

ACCESSIONYP_001303066.1
DESCRIPTIONCASP Target
Description Hidden
ORGANISMParabacteroides distasonis atcc 8503
COMMENT 
DR UNIPROT; A6LCN0_PARD8
DR SPTR; A6LCN0 (flat text); A6LCN0 (good view)
DR GenBank; YP_001303066
DR PDB; 4O2T; Identical; 26-FEB-14; UNCHARACTERIZED PROTEIN;
DR FFAS; 384658; Fold and function assignment.
DR TVPC; YP_001303066.1; Homologs in PDB, JCSG and SG center.
DR OVP; YP_001303066.1; Ortholog view popup.
DR TPM; YP_001303066.1; Target PDB monitor.
DR FSS; YP_001303066.1; Target function coverage.
PROPERTY Residues: 190 aa
Molecule Weight: 21824.79 Dalton
Isoelectric Point: 5.3
Extinction Coefficient: 25330
Gravy Index: -.37
Number of Met residues: 7
Percentage of Met residues: 3.68 %
Number of Cys residues: 3
Percentage of Cys residues: 1.58 %
SEQUENCE  amino acids 190 aa
>YP_001303066.1  gi|150008323|ref|YP_001303066.1| hypothetical protein BDI_1692 [Parabacteroides distasonis ATCC 8503
MKKGFNILLILCAALVAISCSKTKSYTDMLKDEKKAIERFIDDKGLEILDDFPADSVFKE
NQFVLLDNGVYLNIIDKGSDQRAVQYKTKMLYRCKMSYFMDSTIVAIENYGPHSNGTSPI
AFTYGDYSKNSPYDPSYYYVSEGMQEPLKYVGDRAKVKMIVPFKRGAYNDQSNGQPVYYE
ILEYIFEENL

CDS  cDNA 573 bp
   1 atgaagaaag gttttaatat cctgttgatt ctgtgtgccg cattagttgc tatctcttgt    60
  61 agcaagacaa agtcgtacac ggatatgttg aaagatgaga aaaaggcaat cgagcgtttt   120
 121 atcgatgata agggccttga gatcttagat gattttcctg ctgatagcgt atttaaggaa   180
 181 aatcagtttg tgctcttgga taatggtgtc tatttgaata ttattgataa gggaagcgat   240
 241 cagagagcgg tgcaatataa gacgaaaatg ttgtaccgtt gtaagatgag ttacttcatg   300
 301 gattctacta ttgtcgctat tgagaactat ggcccgcata gtaatggaac ttctcctatc   360
 361 gcttttacat atggggatta ttcgaagaat tcaccttatg atccctctta ttattatgta   420
 421 agtgagggaa tgcaagagcc tttgaagtat gttggagatc gggctaaagt gaaaatgata   480
 481 gtgcctttca aaagaggagc ctataatgat caatcaaacg gtcaacctgt atattacgaa   540
 541 attctagaat atatatttga agaaaactta tga   573
Target constructs
Download sequence in PIR or FASTA format
Chemical properties of sequence with tag

Notes

The start codon is a ATG/Methionine in most of sequences, but the GTG/V, TTG/L, CTG/I can be the start codons in some cases as expressing in E.coli. The start codon warning is labelled by RED color in sequence(sample: 10174951).

Protein sequence information contains the annotation contents from both of JCSG and SWISS-PROT. The SWISS-PROT/TrEMBL annotation is accessed from SWALL(SPTR) on the EBI SRS server. PDB homologes show both identical and highly similar proteins with released date and protein function.


Contact Webmaster JCSG Menu