LOADING...
   YP_001303059.1;SP18351A
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
YP_001303059.1    SP18351A            JCSG 421037 PDB Deposition 15-JUL-03              PDB id: 5cd6

Protein Sequence Information


TOPSAN
JCSG Internal annotations

ACCESSIONYP_001303059.1
DESCRIPTIONCASP Target
Description Hidden
ORGANISMParabacteroides distasonis atcc 8503
COMMENT 
DR UNIPROT;
DR SPTR;
DR GenBank;
DR FFAS; 412719; Fold and function assignment.
DR TVPC; YP_001303059.1; Homologs in PDB, JCSG and SG center.
DR OVP; YP_001303059.1; Ortholog view popup.
DR TPM; YP_001303059.1; Target PDB monitor.
DR FSS; YP_001303059.1; Target function coverage.
PROPERTY Residues: 600 aa
Molecule Weight: 68763.23 Dalton
Isoelectric Point: 5.64
Extinction Coefficient: 153670
Gravy Index: -.53
Number of Met residues: 9
Percentage of Met residues: 1.50 %
Number of Cys residues: 6
Percentage of Cys residues: 1.00 %
SEQUENCE  amino acids 600 aa
>YP_001303059.1  gi|150008316|ref|YP_001303059.1| TPR-domain containing protein [Parabacteroides distasonis ATCC 8503
MKAYRLILSLMASVAVGTAFSQTTGVVCEEFDQIQLTHVLTPTGPLPTALDPNGVYPYMS
YSETSNRPVPKRYRMISLENEKVKAIICPDLCGKVISLTHKESGKEVLYRPDVIKYTRIL
PRFYFVAGGIEVSFPISHSPTQNEPVLYQIDHTGDRTYVTCGERESHYGMQWSVEYSLGD
KDECLTQRVVYYNPGKQAYPWMSWSNAALPCAPDTQYDFPNGTVLSHASTLDTIDWKTEG
THHERDIKEMTGYFWKTKDVNAFGAYTPSLGSGLYHIADESSTPGIKLWSYGVAGDKEWS
MLSTPDRQPYVEIQGGPISDQSIKLELRPGEKKNHVEYWIPTDHPLDIYSLKVPALRLRP
IDRIPLFDWARKNESSIWIALADAYKNKSTLPAAPYPEDGQWAPSGMEDLDDAFRWAIQI
SPRPERDYWQFHYGTWLAGRERVEEAIEQLSIPDIDLAKALLARLYVRRQAWEKARDTYA
AIPETSWLNLHPQLVIERDKVLKKFGTEALPEREKWLDKINASSDEWVVERKVQLLIDKK
QYQEAKDLLLSTHFQKVHQTYTRTGLWEQINEGLGLSPQPVPEQLGEDRLARFGAYREYE

CDS  cDNA 1803 bp
   1 atgaaagcat atcgtttaat cctatcactc atggcaagcg tagccgtagg gacagcattc    60
  61 tcgcagacaa caggtgttgt ttgcgaggag ttcgaccaga tacagctgac gcacgtattg   120
 121 acgcccaccg gcccgctacc gactgccttg gacccgaatg gcgtataccc ctatatgagt   180
 181 tatagcgaga cctcaaatcg tccggtgcct aaaaggtacc ggatgatctc gctagagaac   240
 241 gagaaagtca aggccatcat ctgccctgat ctttgcggga aagtaatatc cctcactcac   300
 301 aaggagagcg gcaaggaggt cttgtacagg ccggacgtaa tcaaatacac acggatatta   360
 361 ccccgcttct atttcgtggc cggggggatc gaggtcagtt tcccgatctc ccactctccc   420
 421 acgcaaaatg agccggtgct ttatcagatc gatcatacgg gagaccgcac atatgtaaca   480
 481 tgcggagaac gggaatctca ttacggtatg caatggtctg tagaatattc cttaggagat   540
 541 aaggacgaat gccttaccca aagggttgtt tactacaacc cgggaaagca agcctatcca   600
 601 tggatgtcat ggtccaacgc cgcccttcct tgcgcaccgg atacccaata cgatttcccg   660
 661 aacggaaccg tattatccca tgcctccacg ttggatacga tcgactggaa aacggaagga   720
 721 acccatcatg aacgggatat caaagagatg accggctact tctggaagac gaaagacgtg   780
 781 aacgctttcg gggcttacac cccctccttg ggtagcggcc tctaccacat cgccgacgaa   840
 841 tccagtacgc ccggtatcaa gctatggagt tatggcgtag ccggcgacaa ggaatggtct   900
 901 atgctcagta cccccgaccg gcagccttac gtagaaatcc aaggtggccc gatcagcgac   960
 961 caatctatca agctcgaatt gcgtcccggc gagaaaaaga atcacgtaga atattggata  1020
1021 ccgacagatc atcctttgga tatctattcc ttaaaggttc cggcattaag gcttcgcccg  1080
1081 atcgatcgca tcccgctatt cgactgggcc cggaagaatg aatcttccat ctggatcgcc  1140
1141 ttagccgatg cctataagaa taagtccacg cttcccgccg ccccctatcc ggaagacggg  1200
1201 cagtgggctc catccggcat ggaagatctg gacgatgctt ttcgttgggc gatccaaata  1260
1261 tctccccggc cggaacggga ttattggcaa ttccactatg ggacttggtt ggctggaaga  1320
1321 gaacgtgtag aggaggcgat cgaacaacta tccattccgg atatcgatct ggcgaaagct  1380
1381 ttattggcaa ggctatatgt tcgtcggcag gcgtgggaaa aggcgagaga tacttacgcc  1440
1441 gctatccccg agacctcgtg gttgaaccta catccccagt tggttatcga gcgggataaa  1500
1501 gtattaaaga agtttggaac agaggcttta ccggaacggg aaaaatggtt ggataagata  1560
1561 aacgcgtcct ctgatgaatg ggtggtcgag cgaaaggtac agctactgat tgataagaag  1620
1621 caatatcaag aagccaagga tttattacta tccacccatt tccagaaagt gcatcaaact  1680
1681 tacacccgta cgggactttg ggaacagatc aacgaaggct tgggcctctc cccgcaacct  1740
1741 gtaccggaac aactcggcga ggatcgctta gcccggttcg gtgcctatcg ggaatatgaa  1800
1801 taa  1803
Target constructs
Download sequence in PIR or FASTA format
Chemical properties of sequence with tag

Notes

The start codon is a ATG/Methionine in most of sequences, but the GTG/V, TTG/L, CTG/I can be the start codons in some cases as expressing in E.coli. The start codon warning is labelled by RED color in sequence(sample: 10174951).

Protein sequence information contains the annotation contents from both of JCSG and SWISS-PROT. The SWISS-PROT/TrEMBL annotation is accessed from SWALL(SPTR) on the EBI SRS server. PDB homologes show both identical and highly similar proteins with released date and protein function.


Contact Webmaster JCSG Menu