LOADING...
   YP_001303055.1;TT6518BC
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
YP_001303055.1    TT6518BC            JCSG 416485 PDB Deposition 13-AUG-01              PDB id: 4m0n, 4m0h

Protein Sequence Information


TOPSAN
JCSG Internal annotations

ACCESSIONYP_001303055.1
DESCRIPTIONPutative anti-sigma factor, FecR protein, PF04773 family
ORGANISMParabacteroides distasonis atcc 8503
COMMENT 
DR UNIPROT;
DR SPTR;
DR GenBank;
DR Pfam; PF04773; FecR;
DR PDB; 4M0H; Identical; 16-OCT-13; CONSERVED HYPOTHETICAL PROTEIN, PUTATIVE ANTI-SIG CHAIN: A,;
DR PDB; 4M0N; Identical; 16-OCT-13; CONSERVED HYPOTHETICAL PROTEIN, PUTATIVE ANTI-SIG CHAIN: A;
DR FFAS; 404455; Fold and function assignment.
DR TVPC; YP_001303055.1; Homologs in PDB, JCSG and SG center.
DR OVP; YP_001303055.1; Ortholog view popup.
DR TPM; YP_001303055.1; Target PDB monitor.
DR FSS; YP_001303055.1; Target function coverage.
PROPERTY Residues: 337 aa
Molecule Weight: 38683.77 Dalton
Isoelectric Point: 5.63
Extinction Coefficient: 33350
Gravy Index: -.47
Number of Met residues: 9
Percentage of Met residues: 2.67 %
Number of Cys residues: 0
Percentage of Cys residues: 0.00 %
SEQUENCE  amino acids 337 aa
>YP_001303055.1  gi|150008312|ref|YP_001303055.1| conserved hypothetical protein, putative anti-sigma factor [Parabac
MEEENKYISDLLIRYVNGLYTRNDIETLRKLAASITERAELESEMDRVWNEAQDLPQSDS
HNHLLYKKEAQDLLDKTRKRERRISLSTFIKYAASIAIIVSIGFGAKLYLNHSAKQHTSA
SDHLLTEISVNHGEHKQVTLPDGTVVHLNAGTVMRYPTEFTSDIRLVEMEGEAFFNVMRD
EGKPFIVRTRQADVKVLGTSFNVKAYQEDELMAVSVRTGKVEVDMPESVMRLLPNEQIIV
NNTNGEILKKNEDAQKVTAWLQGGLYFNRTPISSVIHDLERMYNQEIVLDPNVVFDDYIY
GEHDNKSLEAVLNAIQYSTGIRYRKEESRIVLYKTSH

CDS  cDNA 1014 bp
   1 atggaagaag aaaacaaata tataagcgat ttattaatcc gatatgtaaa tggactctat    60
  61 acacggaacg atatagagac cttgcggaag ctagccgcat ccataaccga gcgagcagaa   120
 121 ttagaaagcg aaatggaccg ggtctggaac gaggcgcaag acttacctca atccgattcc   180
 181 cataatcatc tgctttataa gaaggaggcg caagacctgt tggataagac acgtaaaaga   240
 241 gaaagaagaa tctccctatc cactttcatc aagtacgcgg cgagcatagc gattatcgtt   300
 301 tccatcggat tcggagcgaa actataccta aatcattcag caaagcagca tacatctgcc   360
 361 agcgaccatc tcctaacgga aataagcgtc aatcatggcg aacataagca agtcaccctt   420
 421 cccgatggca cggtcgttca tctaaacgcc ggtaccgtca tgcgataccc aacggaattt   480
 481 acctctgaca tccgtttggt agaaatggaa ggagaagctt ttttcaatgt catgagagac   540
 541 gagggcaagc ccttcatcgt ccgtacccgg caagccgacg taaaagtact cggaacctct   600
 601 ttcaacgtaa aagcctatca agaggatgag ttgatggccg tcagcgttcg gaccggaaaa   660
 661 gttgaggtgg atatgcccga aagcgtaatg cgcctattac cgaacgagca gataatcgtg   720
 721 aataacacaa atggagagat tcttaaaaag aacgaggacg cccaaaaagt aacggcttgg   780
 781 ctgcaaggcg gcctttattt caaccggaca cctatcagta gcgttataca cgatttggag   840
 841 cggatgtata atcaagagat cgtactcgat ccgaatgtcg tattcgacga ttacatctat   900
 901 ggcgagcacg acaataaaag tctggaagcc gtactgaacg caattcaata ttcaaccggc   960
 961 atccgatacc ggaaagaaga aagtcggatc gtgttatata aaacgagtca ttaa  1014
Target constructs
Download sequence in PIR or FASTA format
Chemical properties of sequence with tag

Notes

The start codon is a ATG/Methionine in most of sequences, but the GTG/V, TTG/L, CTG/I can be the start codons in some cases as expressing in E.coli. The start codon warning is labelled by RED color in sequence(sample: 10174951).

Protein sequence information contains the annotation contents from both of JCSG and SWISS-PROT. The SWISS-PROT/TrEMBL annotation is accessed from SWALL(SPTR) on the EBI SRS server. PDB homologes show both identical and highly similar proteins with released date and protein function.


Contact Webmaster JCSG Menu