LOADING...
   YP_001302943.1;SP18347A
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
YP_001302943.1    SP18347A            JCSG 419709 PDB Deposition 14-APR-11              PDB id: 4q34

Protein Sequence Information


TOPSAN
JCSG Internal annotations

ACCESSIONYP_001302943.1
DESCRIPTIONCASP Target
Description Hidden
ORGANISMParabacteroides distasonis atcc 8503
COMMENT 
DR UNIPROT;
DR SPTR;
DR GenBank;
DR PDB; 4Q34; Identical; 18-JUN-14; UNCHARACTERIZED PROTEIN;
DR PDB; 1QLW; Highly similar; 10-FEB-00; ESTERASE;
DR PDB; 2WKW; Highly similar; 30-JUN-09; CARBOXYLESTERASE;
DR FFAS; 412715; Fold and function assignment.
DR TVPC; YP_001302943.1; Homologs in PDB, JCSG and SG center.
DR OVP; YP_001302943.1; Ortholog view popup.
DR TPM; YP_001302943.1; Target PDB monitor.
DR FSS; YP_001302943.1; Target function coverage.
PROPERTY Residues: 341 aa
Molecule Weight: 38808.42 Dalton
Isoelectric Point: 5.66
Extinction Coefficient: 57870
Gravy Index: -.24
Number of Met residues: 9
Percentage of Met residues: 2.64 %
Number of Cys residues: 2
Percentage of Cys residues: 0.59 %
SEQUENCE  amino acids 341 aa
>YP_001302943.1  gi|150008200|ref|YP_001302943.1| hypothetical protein BDI_1566 [Parabacteroides distasonis ATCC 8503
MRPVFILGIILLLVGCKQRDERVLMVDEQGSFAVGGTVLVDSLGHTFHGDHAYVFYQKPV
GARKYPLVFAHGVGQFSKTWETTPDGREGFQNIFLRRRFCVYLVDQPRRGNAGRGTESVT
ISPAFDEEVWFNRFRVGIWPDYFEGVQFKRDKETLDQYFRQMTPTIGTTDFEVYSDAYAA
LFDKIGPGVFITHSQGGPVGWNTLLKTRNIKAIASYEPGGAVPFPEGQLPEEAKFITLSK
KMEGIEVPMSVFMEYTKVPIVIYYGDNLPETDERPELYEWTRRLRLMKIWAKMLNDQGGD
VTVIHLPEVGLHGNTHFPMSDLNNIEVADLLSEWLHTKALD

CDS  cDNA 1026 bp
   1 atgagacctg tttttatact tggtatcatt ctcttgcttg ttggatgtaa acagcgagat    60
  61 gagcgtgttc tgatggtgga tgagcaaggc agcttcgctg ttggaggtac ggtcttggtt   120
 121 gattcattag ggcatacttt tcatggcgac catgcgtacg tattttatca aaagccggtc   180
 181 ggagcgagga aatacccatt ggtattcgcc catggtgtag ggcagttttc taagacatgg   240
 241 gaaaccacac ccgacgggcg tgagggcttc cagaatattt tcttacgtcg ccggttttgt   300
 301 gtctatcttg tcgatcagcc tcgtagaggg aacgccggta gaggtacgga gagcgtgaca   360
 361 atttctccgg cgtttgacga ggaggtttgg tttaaccgtt ttcgtgtagg tatctggccg   420
 421 gattattttg aaggagtaca gtttaagcgg gataaggaaa ccttggacca atactttcgt   480
 481 caaatgacgc cgactattgg cacgacggat tttgaggtct attcggatgc ctacgccgct   540
 541 ttgttcgaca agataggccc gggcgtattt attacccatt cgcaaggcgg gcccgttgga   600
 601 tggaatacat tgcttaagac gagaaacatt aaggctatcg catcatacga accgggtgga   660
 661 gcggttcctt ttccggaagg gcaattgccg gaggaggcta agtttattac gctttccaag   720
 721 aaaatggaag gcattgaagt acctatgtcc gtattcatgg aatataccaa ggtccctatc   780
 781 gtcatttatt atggagataa tttacccgaa accgatgagc gtccggagtt atatgaatgg   840
 841 acacgccgtt tgcgcttgat gaagatatgg gcaaaaatgc tgaatgatca gggtggggat   900
 901 gtcaccgtta ttcatttacc ggaggtagga ttacatggca atacccattt ccctatgtcg   960
 961 gatttaaata atatagaggt tgcggatttg ctttctgaat ggttacatac aaaagctttg  1020
1021 gactag  1026
Target constructs
Download sequence in PIR or FASTA format
Chemical properties of sequence with tag

Notes

The start codon is a ATG/Methionine in most of sequences, but the GTG/V, TTG/L, CTG/I can be the start codons in some cases as expressing in E.coli. The start codon warning is labelled by RED color in sequence(sample: 10174951).

Protein sequence information contains the annotation contents from both of JCSG and SWISS-PROT. The SWISS-PROT/TrEMBL annotation is accessed from SWALL(SPTR) on the EBI SRS server. PDB homologes show both identical and highly similar proteins with released date and protein function.


Contact Webmaster JCSG Menu