LOADING...
   YP_001302625.1;GS13649A
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
YP_001302625.1    GS13649A            JCSG 394759 PDB Deposition 13-JUN-17              PDB id: 4l8n

Protein Sequence Information


TOPSAN
JCSG Internal annotations

ACCESSIONYP_001302625.1
DESCRIPTIONCASP Target
Description Hidden
ORGANISMParabacteroides distasonis atcc 8503
COMMENT 
DR UNIPROT; A6LBD9_PARD8
DR SPTR; A6LBD9 (flat text); A6LBD9 (good view)
DR GenBank; YP_001302625
DR Pfam; PF00595; PDZ;
DR PDB; 4L8N; Identical; 26-JUN-13; PDZ DOMAIN PROTEIN;
DR FFAS; 384070; Fold and function assignment.
DR TVPC; YP_001302625.1; Homologs in PDB, JCSG and SG center.
DR OVP; YP_001302625.1; Ortholog view popup.
DR TPM; YP_001302625.1; Target PDB monitor.
DR FSS; YP_001302625.1; Target function coverage.
PROPERTY Residues: 476 aa
Molecule Weight: 54431.15 Dalton
Isoelectric Point: 6.22
Extinction Coefficient: 59710
Gravy Index: -.35
Number of Met residues: 10
Percentage of Met residues: 2.10 %
Number of Cys residues: 9
Percentage of Cys residues: 1.89 %
SEQUENCE  amino acids 476 aa
>YP_001302625.1  gi|150007882|ref|YP_001302625.1| PDZ domain protein [Parabacteroides distasonis ATCC 8503]
MMRSVILSTLLLVLAVCTVSAQNRNTSICRLGFTYDISQSKNWGNNKPVIKSIIPYSSAE
QAGIKKYDVIEEINGVPVTEVSVDEIPQLLNPAGRNDVLLTISNLSSPSKQVLVKKDCKK
SNAITEDQLASAYAMYSLETTNEQEFVCPFKTTVTSDGVDFGNFKTFAFSTIDENNRKLE
TVINECIENELTKKGLTVDIAKPDLLIQTFYFFDKNPNYLGANKVLVEKEPTYRYNFSHS
KMEKFPFLNYAAAEAEAEYLLQFGIRIIDQKDIPGRVLWECEANELLEDSYRLDEYARVH
VPLMCMQYPYTKYGRNVPFKVSKKTYNYTGISYDIDKLDQVVDVDRNSPAYAAGIRPRDI
IEKIGRHKMDHSAEEFSSAYKRFITNTMQYRDPKTMFTDANGFKYCMFWDVFKYPQIADA
SQSSDYLPAFSYLYYFAPYINPSGNNACTFNIKRGKTKLEVIIRPTIRSEVTVEIK

CDS  cDNA 1431 bp
   1 atgatgagaa gtgtgatttt atcaacgttg ctattagtat tggcggtctg tacggtttcc    60
  61 gcccaaaaca ggaatacatc catctgccga ctaggcttca catacgatat cagccagagc   120
 121 aagaactggg gaaacaacaa gccggtcatt aaaagtatca tcccttattc atccgccgag   180
 181 caagcaggta ttaagaaata tgacgtgatc gaggagatca acggggtacc cgtgacggag   240
 241 gtatctgtcg acgagatccc tcaactgctg aatcccgccg gaagaaacga tgtcctattg   300
 301 actatcagca acctttcctc tccttctaaa caagtattgg taaagaagga ctgcaagaaa   360
 361 agtaacgcca tcacggaaga ccagctggcg tccgcctatg cgatgtatag cttggagaca   420
 421 accaatgagc aagaattcgt atgcccgttc aagactaccg tcacatccga cggcgtagat   480
 481 ttcggtaact tcaagacatt cgccttctcg accatcgacg agaataaccg taaactggaa   540
 541 acggtcatca acgaatgcat cgagaacgag ttgaccaaaa aaggacttac ggttgatatc   600
 601 gcgaagccgg atttattgat acagactttc tattttttcg ataagaaccc gaactatctg   660
 661 ggagcgaata aagtattggt agaaaaagaa ccgacttacc ggtacaactt ctcgcacagt   720
 721 aagatggaga aattcccgtt cttgaattac gccgccgccg aagcggaagc cgaatatctg   780
 781 ttgcaattcg gtatccgtat catcgatcaa aaagatatcc ccggacgtgt actctgggaa   840
 841 tgtgaggcga acgagttgct ggaagactct tatcgtttag acgaatacgc ccgggtgcat   900
 901 gtcccgttga tgtgtatgca atacccatac acgaaatacg gacgtaacgt accgttcaag   960
 961 gtgagcaaga agacctataa ttatacgggg atcagctacg atatcgataa attggatcaa  1020
1021 gtggttgacg tagatcgtaa ctctcccgct tatgcggcag gcatccgtcc ccgtgacatt  1080
1081 atagaaaaga tcggccgcca taagatggat cattcggcag aggagttctc atccgcctac  1140
1141 aaacgcttta tcacgaacac gatgcaatat cgtgatccga agacgatgtt tacggatgcg  1200
1201 aacggtttca agtattgcat gttctgggac gtattcaaat atccccaaat agcggatgcg  1260
1261 tcgcaaagct ccgattactt gccggcgttc tcttatttat actatttcgc cccttatatt  1320
1321 aatccgtccg gcaacaacgc ctgtacattt aatataaagc gtggcaagac aaaattagaa  1380
1381 gtaattatcc gtcctaccat tcgctctgaa gtgacggtag agatcaaata a  1431
Target constructs
Download sequence in PIR or FASTA format
Chemical properties of sequence with tag

Notes

The start codon is a ATG/Methionine in most of sequences, but the GTG/V, TTG/L, CTG/I can be the start codons in some cases as expressing in E.coli. The start codon warning is labelled by RED color in sequence(sample: 10174951).

Protein sequence information contains the annotation contents from both of JCSG and SWISS-PROT. The SWISS-PROT/TrEMBL annotation is accessed from SWALL(SPTR) on the EBI SRS server. PDB homologes show both identical and highly similar proteins with released date and protein function.


Contact Webmaster JCSG Menu