LOADING...
   YP_001302047.1;GS13894A
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
YP_001302047.1    GS13894A            JCSG 394800 PDB Deposition 13-AUG-21              PDB id: 4mcj

Protein Sequence Information


TOPSAN
JCSG Internal annotations

ACCESSIONYP_001302047.1
DESCRIPTIONCASP Target
Description Hidden
ORGANISMParabacteroides distasonis atcc 8503
COMMENT 
DR UNIPROT; A6L9R1_PARD8
DR SPTR; A6L9R1 (flat text); A6L9R1 (good view)
DR GenBank; YP_001302047
DR PDB; 4MCJ; Identical; 04-SEP-13; UNCHARACTERIZED PROTEIN;
DR FFAS; 384801; Fold and function assignment.
DR TVPC; YP_001302047.1; Homologs in PDB, JCSG and SG center.
DR OVP; YP_001302047.1; Ortholog view popup.
DR TPM; YP_001302047.1; Target PDB monitor.
DR FSS; YP_001302047.1; Target function coverage.
PROPERTY Residues: 174 aa
Molecule Weight: 20178.4 Dalton
Isoelectric Point: 5.45
Extinction Coefficient: 28420
Gravy Index: -.11
Number of Met residues: 9
Percentage of Met residues: 5.17 %
Number of Cys residues: 4
Percentage of Cys residues: 2.30 %
SEQUENCE  amino acids 174 aa
>YP_001302047.1  gi|150007304|ref|YP_001302047.1| hypothetical protein BDI_0649 [Parabacteroides distasonis ATCC 8503
MNTRNIVLCILYLFLVPMGGFAQSEVVVLYPDTENKDLDEAVYQKIFLAGTIDMGKSVDW
QKATCDWFRALPEGRYLLFNPRRDKGLSGEMSDFEHQVNWELEHLEKADLIIMNILASSK
SPITLLEMGLFMRSGKLRVICEPGFYRYDNVRLTCARYGVPLYQNMDDFLKTMR

CDS  cDNA 525 bp
   1 atgaatacga gaaatattgt actgtgtata ttatatttgt ttttggtgcc gatgggaggg    60
  61 tttgcccaat ctgaggtcgt tgtcttgtat cccgatactg aaaataagga tttggatgaa   120
 121 gcagtatacc aaaaaatctt tttggccggc acgatcgata tggggaaaag tgtggattgg   180
 181 cagaaggcta cctgcgactg gttccgagcg cttccggagg gacggtatct cttgttcaat   240
 241 cctcgtaggg ataaagggtt gagcggggag atgtccgatt ttgagcatca agtgaattgg   300
 301 gaactggagc atctggagaa agccgatctg attatcatga acattctggc gagcagcaaa   360
 361 tccccgataa ctttattgga gatggggctg tttatgcgct ccggaaagtt gcgggtgatt   420
 421 tgcgagcccg gcttttaccg gtatgataat gtgcgcttaa cttgtgcgcg ctatggcgtc   480
 481 ccattgtatc agaatatgga cgattttttg aaaaccatgc gctaa   525
Target constructs
Download sequence in PIR or FASTA format
Chemical properties of sequence with tag

Notes

The start codon is a ATG/Methionine in most of sequences, but the GTG/V, TTG/L, CTG/I can be the start codons in some cases as expressing in E.coli. The start codon warning is labelled by RED color in sequence(sample: 10174951).

Protein sequence information contains the annotation contents from both of JCSG and SWISS-PROT. The SWISS-PROT/TrEMBL annotation is accessed from SWALL(SPTR) on the EBI SRS server. PDB homologes show both identical and highly similar proteins with released date and protein function.


Contact Webmaster JCSG Menu