LOADING...
   YP_001300326.1;GS13437B
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
YP_001300326.1    GS13437B            JCSG 385767 PDB Deposition 15-MAR-03              PDB id: 4yjw

Protein Sequence Information


TOPSAN
JCSG Internal annotations

ACCESSIONYP_001300326.1
DESCRIPTIONCASP Target
Description Hidden
ORGANISMBacteroides vulgatus atcc 8482
COMMENT 
DR UNIPROT; A6L4U0_BACV8
DR SPTR; A6L4U0 (flat text); A6L4U0 (good view)
DR GenBank; YP_001300326
DR PDB; 4YJW; Identical; 18-MAR-15; DUF3829 FAMILY PROTEIN;
DR PDB; 3IEE; Highly similar; 11-AUG-09; PUTATIVE EXPORTED PROTEIN;
DR PDB; 3RH3; Highly similar; 04-MAY-11; UNCHARACTERIZED DUF3829-LIKE PROTEIN;
DR FFAS; 384391; Fold and function assignment.
DR TVPC; YP_001300326.1; Homologs in PDB, JCSG and SG center.
DR OVP; YP_001300326.1; Ortholog view popup.
DR TPM; YP_001300326.1; Target PDB monitor.
DR FSS; YP_001300326.1; Target function coverage.
PROPERTY Residues: 194 aa
Molecule Weight: 21937 Dalton
Isoelectric Point: 7.64
Extinction Coefficient: 17880
Gravy Index: -.29
Number of Met residues: 6
Percentage of Met residues: 3.09 %
Number of Cys residues: 2
Percentage of Cys residues: 1.03 %
SEQUENCE  amino acids 194 aa
>YP_001300326.1  gi|150005582|ref|YP_001300326.1| hypothetical protein BVU_3067 [Bacteroides vulgatus ATCC 8482]
MKKNLLLYGVFLCALSISSCSGGSKSSHVMDSSSMSVENANEVMKYYDTSLKILKDLVNE
NEIKAVLGYLDQKMPVDSLPVVSQPVVSVQDTVFVSNPGNYFSENDRQNLKENYGRLFRS
ISAFYENYKTYRLYMQDQSYKKDNNALADKIRKEELLLSIALSEYKQVIFDILTPIVEGA
KITLTPIKGNVKDK

CDS  cDNA 585 bp
   1 atgaagaaga atttattatt gtatggtgtg tttctttgcg ccctctccat atcctcttgt    60
  61 tccggtggct ccaagagtag tcacgttatg gatagcagta gcatgagtgt ggagaatgcg   120
 121 aatgaagtga tgaagtatta tgatacctca ttgaaaatct tgaaagactt agttaatgag   180
 181 aatgagataa aagcggtgct gggctatttg gatcagaaga tgccggtaga ttctctgcct   240
 241 gtggtatcac agcctgtggt ttctgttcaa gatacagtgt ttgtttctaa tccgggaaat   300
 301 tacttcagtg agaatgatcg tcagaatctg aaggaaaatt atggccgctt gttccggtct   360
 361 atttccgcat tttatgagaa ctataagact taccggctgt atatgcagga tcaatcatat   420
 421 aaaaaggata ataatgcttt ggcggataag ataagaaaag aggagctatt attgagtatt   480
 481 gctttatctg aatacaaaca ggttattttt gatatattaa ctccgatagt tgaaggggct   540
 541 aaaataaccc tgacccctat aaagggaaat gttaaagata aatag   585
Target constructs
Download sequence in PIR or FASTA format
Chemical properties of sequence with tag

Notes

The start codon is a ATG/Methionine in most of sequences, but the GTG/V, TTG/L, CTG/I can be the start codons in some cases as expressing in E.coli. The start codon warning is labelled by RED color in sequence(sample: 10174951).

Protein sequence information contains the annotation contents from both of JCSG and SWISS-PROT. The SWISS-PROT/TrEMBL annotation is accessed from SWALL(SPTR) on the EBI SRS server. PDB homologes show both identical and highly similar proteins with released date and protein function.


Contact Webmaster JCSG Menu