LOADING...
   YP_001300035.1;GS13864A
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
YP_001300035.1    GS13864A            JCSG 385752 PDB Deposition 14-MAY-28              PDB id: 4qhb

Protein Sequence Information


TOPSAN
JCSG Internal annotations

ACCESSIONYP_001300035.1
DESCRIPTIONCASP Target
Description Hidden
ORGANISMBacteroides vulgatus atcc 8482
COMMENT 
DR UNIPROT; A6L3Z9_BACV8
DR SPTR; A6L3Z9 (flat text); A6L3Z9 (good view)
DR GenBank; YP_001300035
DR PDB; 4QHB; Identical; 18-JUN-14; UNCHARACTERIZED PROTEIN;
DR PDB; 3KS7; Highly similar; 15-DEC-09; PUTATIVE PUTATIVE PNGASE F;
DR PDB; 4R4X; Highly similar; 28-JAN-15; PNGF-II;
DR PDB; 4R4Z; Highly similar; 28-JAN-15; PNGF-II;
DR FFAS; 384476; Fold and function assignment.
DR TVPC; YP_001300035.1; Homologs in PDB, JCSG and SG center.
DR OVP; YP_001300035.1; Ortholog view popup.
DR TPM; YP_001300035.1; Target PDB monitor.
DR FSS; YP_001300035.1; Target function coverage.
PROPERTY Residues: 416 aa
Molecule Weight: 46691.99 Dalton
Isoelectric Point: 5.68
Extinction Coefficient: 76320
Gravy Index: -.23
Number of Met residues: 13
Percentage of Met residues: 3.12 %
Number of Cys residues: 5
Percentage of Cys residues: 1.20 %
SEQUENCE  amino acids 416 aa
>YP_001300035.1  gi|150005291|ref|YP_001300035.1| hypothetical protein BVU_2763 [Bacteroides vulgatus ATCC 8482]
MNLLTFIAPLAVAATFMMPADAANHKELPALGNTHIQVFDKTPVCFRPDSFPNYTPANAD
GVIRLVNGRIILKKITLPDYKRDVDVTLKVTVASNGDRWDKSGSCFVLPKESVINLMNIA
EGKRAFPAVDSTKYEKMIGIVPGQDYVPTLELMRFMTPFGVGYYSSDNDSLSSKRRPVYI
PKWEKSVTWVQDITDLYPALEREAYVGIYIDTWTAEGYVASMELDVKESKITCDVMPERR
VKPLMNTVYYIGQTYPDIFSRKDVVMDFDMPKAAKNVRLKYIVTGHGGHSGGDEFVEKRN
IVSVDGKEVLNFIPWRDDCASFRRFNPATGVWLIPRVAAYIGDKGYTTKEIEEPLASSDL
SRSNWCPGSDVMPEEAVIGDLSAGKHSFKVSIPEAQQVDGNKLNHWLVSAYLVWEE

CDS  cDNA 1251 bp
   1 atgaacctgc tgacctttat tgccccactg gctgtggcgg caacttttat gatgccggcc    60
  61 gatgctgcaa atcacaaaga attaccggca ttgggaaata ctcatattca agtattcgac   120
 121 aaaacccctg tttgttttcg tcccgattct ttccctaatt atactcctgc caatgctgac   180
 181 ggagtgatcc gtctggtaaa cgggcgtatc attttaaaga aaataacctt gcccgattat   240
 241 aaaagggatg tggatgttac tctgaaagta actgtagctt ccaatggtga ccgttgggat   300
 301 aaatctggct cttgttttgt gcttcccaaa gaatcggtga ttaatctgat gaatatagcc   360
 361 gaaggcaaga gggcgtttcc tgcggtagac agtaccaaat atgaaaaaat gattggtatt   420
 421 gttccgggtc aggattatgt gcctaccctt gaactgatgc gttttatgac cccgttcggt   480
 481 gtggggtatt atagttcgga taatgattct ttgagcagca agaggcgtcc tgtatatatc   540
 541 ccgaaatggg aaaagagtgt gacttgggtg caggatatta ccgatcttta tccggcattg   600
 601 gagagagagg catacgtggg aatttatatt gatacatgga ctgccgaggg gtatgtggcc   660
 661 agtatggaat tggatgtgaa ggagagtaag atcacttgcg acgtgatgcc ggagcgccgt   720
 721 gtgaagcctt tgatgaatac ggtgtattat atcggacaga cttatccgga tattttctca   780
 781 cgcaaagatg tggtgatgga ttttgatatg ccgaaagctg ccaagaatgt tcgtttgaag   840
 841 tatattgtaa caggtcacgg aggacatagt ggcggagatg agtttgtgga gaaacggaac   900
 901 atcgtgtctg ttgatggcaa ggaggtgttg aatttcattc cttggcgtga tgactgtgct   960
 961 tctttccgcc gttttaatcc ggccacggga gtatggctga taccacgagt tgccgcatat  1020
1021 ataggtgata aggggtatac gacaaaagag attgaagaac ctttggcttc ttcggatttg  1080
1081 tcccgttcca attggtgtcc gggtagcgat gtgatgcctg aggaggctgt tattggtgac  1140
1141 ttgtcggccg gtaaacattc ttttaaggta agtatccctg aggcacaaca ggtagatggc  1200
1201 aataaattga atcattggct ggtttcagct tatttggttt gggaggaata a  1251
Target constructs
Download sequence in PIR or FASTA format
Chemical properties of sequence with tag

Notes

The start codon is a ATG/Methionine in most of sequences, but the GTG/V, TTG/L, CTG/I can be the start codons in some cases as expressing in E.coli. The start codon warning is labelled by RED color in sequence(sample: 10174951).

Protein sequence information contains the annotation contents from both of JCSG and SWISS-PROT. The SWISS-PROT/TrEMBL annotation is accessed from SWALL(SPTR) on the EBI SRS server. PDB homologes show both identical and highly similar proteins with released date and protein function.


Contact Webmaster JCSG Menu