LOADING...
   YP_001299918.1;GS13848A
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
YP_001299918.1    GS13848A            JCSG 385740 PDB Deposition 14-MAY-21              PDB id: 4qfu

Protein Sequence Information


TOPSAN
JCSG Internal annotations

ACCESSIONYP_001299918.1
DESCRIPTIONCASP Target
Description Hidden
ORGANISMBacteroides vulgatus atcc 8482
COMMENT 
DR UNIPROT; A6L3N2_BACV8
DR SPTR; A6L3N2 (flat text); A6L3N2 (good view)
DR GenBank; YP_001299918
DR PDB; 4QFU; Identical; 02-JUL-14; GLYCOSIDE HYDROLASE FAMILY 5;
DR PDB; 3KZS; Highly similar; 29-DEC-10; GLYCOSYL HYDROLASE FAMILY 5;
DR FFAS; 384453; Fold and function assignment.
DR TVPC; YP_001299918.1; Homologs in PDB, JCSG and SG center.
DR OVP; YP_001299918.1; Ortholog view popup.
DR TPM; YP_001299918.1; Target PDB monitor.
DR FSS; YP_001299918.1; Target function coverage.
PROPERTY Residues: 489 aa
Molecule Weight: 56333.64 Dalton
Isoelectric Point: 6.29
Extinction Coefficient: 142210
Gravy Index: -.6
Number of Met residues: 15
Percentage of Met residues: 3.07 %
Number of Cys residues: 4
Percentage of Cys residues: 0.82 %
SEQUENCE  amino acids 489 aa
>YP_001299918.1  gi|150005174|ref|YP_001299918.1| hypothetical protein BVU_2644 [Bacteroides vulgatus ATCC 8482]
MNRHALLSLLALLLCCSTSLPAQKAKTYIPWKNGKLVVSEEGRYLKHENGVPFFWLGETG
WLMPQRLNRDEVSYYLNKCKDAGYNMVQVQVLNGVPSMNIYGQYSMTDGFNFKDINRKGI
YGYWDHMDYIIKSAASRGIYIGMVCIWGTPVEQGLMNEKEAVAYGKFLAERYKDEPNIIW
MIGGDIRGDNKTEVWDALANSIRSIDKGHLMTFHPRGRTTSATWFNDREWLDFNMFQSGH
RRYGQRNGDGDYPIEENTEEDNWRFVEASQAKTPLKPVIDDEPIYEDIPQGLHDPNETRW
NQHDVRRYAYWSVFAGSFGHSYGHNDIMQFIRPGYGASFGADGRKKAWWDALEDPGFNQM
KYLKNLMLTFPFFERVPDQSVIAGTNGERYDRAIATRGNDYLLVYNYSGRPMQIDLSKIS
GAKKNAWWYSAKDGKLEYIGEFDSKVTSFQHDSGYLSGNDQVLIVVDSAKDYVQKAWTAL
PDAIQKWNK

CDS  cDNA 1470 bp
   1 atgaacagac acgcattact ttccttattg gctttattgc tatgttgctc tacttcgttg    60
  61 ccggcgcaga aagcgaaaac gtatattccc tggaagaacg gcaaactggt ggtgtccgag   120
 121 gagggacgct acctgaagca tgaaaatgga gtacctttct tctggttggg tgaaaccgga   180
 181 tggctgatgc cgcaacgttt gaatcgtgac gaggtttctt actatctgaa taagtgcaag   240
 241 gatgccggat ataacatggt gcaggtgcag gtattgaacg gtgtgccttc catgaatatt   300
 301 tacggccagt attccatgac agacggtttt aatttcaaag atatcaaccg caaagggatt   360
 361 tatggatatt gggaccacat ggactatatt attaaaagtg ccgcttcacg gggtatctat   420
 421 atagggatgg tatgtatttg gggaactccc gtggaacaag ggctgatgaa tgaaaaagaa   480
 481 gccgtggcat acggtaagtt tcttgcagaa cgttacaagg atgagccgaa tattatttgg   540
 541 atgataggag gggatatccg cggtgataat aagacggagg tatgggatgc gttggcaaac   600
 601 agtatccgca gcatagacaa aggtcatctg atgactttcc atccgcgtgg acgtactacg   660
 661 tcggctactt ggtttaatga ccgcgaatgg ctggatttca atatgttcca aagcggacac   720
 721 cgtcgttacg ggcagcgtaa cggtgatggt gactatccta tcgaagagaa tacggaagag   780
 781 gataactggc gttttgtgga agccagtcag gcaaagactc cgttgaaacc ggtgattgat   840
 841 gacgaaccta tttatgaaga cattccacag gggctgcatg atcccaatga aacccgttgg   900
 901 aatcagcacg atgtgcgtcg ttatgcctat tggtcggtat ttgccggatc attcgggcac   960
 961 tcatacggtc ataatgatat catgcaattt atccgtcccg gatatggagc ctctttcggc  1020
1021 gccgacggac gtaagaaagc atggtgggat gctttggaag accccggttt caatcagatg  1080
1081 aaatatctga agaacttgat gctgactttt cctttctttg aacgtgtacc cgatcagagt  1140
1141 gtcattgcag gaactaacgg cgaacgctat gaccgtgcca tcgctacccg tggaaatgac  1200
1201 tatttgctgg tttacaatta ctcaggacgt cctatgcaga tcgatttgag caaaatcagc  1260
1261 ggtgcgaaaa agaatgcatg gtggtatagc gcgaaggacg gtaagttgga atatatcggt  1320
1321 gagtttgaca gtaaagtcac ttctttccag catgatagcg gttatctgag cggcaatgat  1380
1381 caggttctga ttgttgtgga ttctgcgaag gattatgtgc agaaagcttg gacagccttg  1440
1441 ccggatgcca tacagaaatg gaataagtaa  1470
Target constructs
Download sequence in PIR or FASTA format
Chemical properties of sequence with tag

Notes

The start codon is a ATG/Methionine in most of sequences, but the GTG/V, TTG/L, CTG/I can be the start codons in some cases as expressing in E.coli. The start codon warning is labelled by RED color in sequence(sample: 10174951).

Protein sequence information contains the annotation contents from both of JCSG and SWISS-PROT. The SWISS-PROT/TrEMBL annotation is accessed from SWALL(SPTR) on the EBI SRS server. PDB homologes show both identical and highly similar proteins with released date and protein function.


Contact Webmaster JCSG Menu