LOADING...
   YP_001299901.1;SP13795F
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
YP_001299901.1    SP13795F            JCSG 419464 PDB Deposition 15-APR-22              PDB id: 4zgf

Protein Sequence Information


TOPSAN
JCSG Internal annotations

ACCESSIONYP_001299901.1
DESCRIPTIONCASP Target
Description Hidden
ORGANISMBacteroides vulgatus atcc 8482
COMMENT 
DR UNIPROT;
DR SPTR;
DR GenBank;
DR FFAS; 409856; Fold and function assignment.
DR TVPC; YP_001299901.1; Homologs in PDB, JCSG and SG center.
DR OVP; YP_001299901.1; Ortholog view popup.
DR TPM; YP_001299901.1; Target PDB monitor.
DR FSS; YP_001299901.1; Target function coverage.
PROPERTY Residues: 164 aa
Molecule Weight: 18542.85 Dalton
Isoelectric Point: 5.54
Extinction Coefficient: 30940
Gravy Index: -.5
Number of Met residues: 3
Percentage of Met residues: 1.83 %
Number of Cys residues: 1
Percentage of Cys residues: 0.61 %
SEQUENCE  amino acids 164 aa
>YP_001299901.1  gi|150005157|ref|YP_001299901.1| hypothetical protein BVU_2626 [Bacteroides vulgatus ATCC 8482]
MKLKSILYILMLLPFLWSCNNEDDVEEIFASGTWHVVDFYGKANWDKRNGEPKYNAMAHN
PDKTIATEGRKALDIIHGFNITFKADGTFTGSIQNGTIEGTWQADGKDRTVNINFTKTPP
STSYNNEFIEALNNAIFYQGDSNVLLLAPEGKKTYIQFAHNKQD

CDS  cDNA 495 bp
   1 atgaaactaa agtctattct ttatatacta atgctactcc ctttcttatg gagttgcaac    60
  61 aatgaagacg atgtagagga aatctttgca agcggcacat ggcatgtagt ggatttctat   120
 121 ggtaaagcaa attgggacaa acggaacgga gagcccaaat acaatgcaat ggcacacaat   180
 181 ccggataaga ctatcgcaac cgaaggaaga aaagccttgg atatcattca tggtttcaac   240
 241 atcactttca aagcggatgg tacttttaca ggaagcatac aaaatggaac cattgaaggc   300
 301 acatggcaag cggacggaaa agaccggaca gtaaacataa actttaccaa gactccgcct   360
 361 tcaacaagct ataacaacga gttcatagaa gcattgaata atgcaatatt ttatcaaggt   420
 421 gacagcaatg ttttattgct agctcccgaa gggaaaaaaa cttatattca atttgcacat   480
 481 aataagcaag actga   495
Target constructs
Download sequence in PIR or FASTA format
Chemical properties of sequence with tag

Notes

The start codon is a ATG/Methionine in most of sequences, but the GTG/V, TTG/L, CTG/I can be the start codons in some cases as expressing in E.coli. The start codon warning is labelled by RED color in sequence(sample: 10174951).

Protein sequence information contains the annotation contents from both of JCSG and SWISS-PROT. The SWISS-PROT/TrEMBL annotation is accessed from SWALL(SPTR) on the EBI SRS server. PDB homologes show both identical and highly similar proteins with released date and protein function.


Contact Webmaster JCSG Menu