LOADING...
   YP_001299801.1;GS13876A
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
YP_001299801.1    GS13876A            JCSG 385726 PDB Deposition 14-MAY-06              PDB id: 4qb7

Protein Sequence Information


TOPSAN
JCSG Internal annotations

ACCESSIONYP_001299801.1
DESCRIPTIONCASP Target
Description Hidden
ORGANISMBacteroides vulgatus atcc 8482
COMMENT 
DR UNIPROT; A6L3B5_BACV8
DR SPTR; A6L3B5 (flat text); A6L3B5 (good view)
DR GenBank; YP_001299801
DR PDB; 4QB7; Identical; 02-JUL-14; UNCHARACTERIZED PROTEIN;
DR FFAS; 384495; Fold and function assignment.
DR TVPC; YP_001299801.1; Homologs in PDB, JCSG and SG center.
DR OVP; YP_001299801.1; Ortholog view popup.
DR TPM; YP_001299801.1; Target PDB monitor.
DR FSS; YP_001299801.1; Target function coverage.
PROPERTY Residues: 379 aa
Molecule Weight: 42241.78 Dalton
Isoelectric Point: 4.85
Extinction Coefficient: 63370
Gravy Index: -.56
Number of Met residues: 9
Percentage of Met residues: 2.37 %
Number of Cys residues: 2
Percentage of Cys residues: 0.53 %
SEQUENCE  amino acids 379 aa
>YP_001299801.1  gi|150005057|ref|YP_001299801.1| hypothetical protein BVU_2522 [Bacteroides vulgatus ATCC 8482]
MEVKSLLMVMATLTIAGCSQNEMTEMNPDTNRTIGLDVYTEVQTRGTETTTSTLKANAGF
GIFAYQTSSAGWNSEKGNTTPNFMYNEHATWTSDSWGYTNLRFWPIDDKKITFFAYAPYE
SKPEVGTDQKITLSGQNAKGAPTITFEVKTSNNWKDMIDLVTDCHTAIQDQTNESNKGTV
QFKFSHVLTQIANIKVKPDVNLGTDTKIFVTGLKLDPGSTTLYNKAVYKFDNDTWEAISP
DASYFSTEQDLSDFLNKTTTDQWGYNKSSINVSDDQNATALFSDTEALYFIPVNNKNGTT
NAGDLKLKINYDIVTKVTDTSNLTSTITNKEVSLPKNTFKKGTKHTYVLTIKMNAIKITV
EDNMEGWTDDSDSDINVEK

CDS  cDNA 1140 bp
   1 atggaagtga aaagtttatt gatggtgatg gcaacactga ctatagctgg ttgctcacag    60
  61 aatgaaatga cagaaatgaa tccggatacg aaccggacaa tcgggttgga cgtatatacg   120
 121 gaagtacaga ccagaggaac ggaaactaca acgtccacat tgaaagcaaa tgccggtttc   180
 181 ggtatttttg cctatcagac aagcagtgcg ggatggaata gtgaaaaagg aaacacaaca   240
 241 cctaatttca tgtacaatga acatgctaca tggacttctg atagttgggg atatactaat   300
 301 ttacgttttt ggccaataga tgataagaaa ataacattct ttgcttatgc gccttatgaa   360
 361 tccaaaccgg aagttggaac agaccaaaaa ataactttat caggacagaa tgccaaaggc   420
 421 gctccgacaa tcacctttga ggtaaagact tctaataact ggaaagatat gatagatttg   480
 481 gtaacagact gccatactgc catacaagac caaactaatg aaagtaataa ggggacggtt   540
 541 cagttcaagt ttagtcacgt acttacccaa atagccaata tcaaggtgaa gccagatgtg   600
 601 aacttaggta ctgataccaa aatttttgta acgggattaa agttagatcc aggaagtaca   660
 661 acactttaca acaaggctgt ttataaattc gataacgaca cttgggaagc catatctcct   720
 721 gacgcatctt atttttcaac agaacaagac ctgagtgatt ttttaaataa aacaaccacc   780
 781 gaccaatggg gatataataa aagttctatc aatgtaagtg atgaccagaa tgcaaccgcg   840
 841 ttattctcag atacagaagc tctttacttt attccggtaa ataacaaaaa cggtaccacc   900
 901 aacgcaggtg acttaaaact gaaaatcaat tatgacatcg taaccaaagt gaccgacaca   960
 961 agtaatctga caagtaccat aacaaacaaa gaagtttcac taccgaaaaa tacgttcaag  1020
1021 aaaggaacga aacataccta cgtattgact atcaagatga atgccattaa gattacggtg  1080
1081 gaggataata tggaaggttg gactgatgat agcgactctg atattaatgt agagaaataa  1140
Target constructs
Download sequence in PIR or FASTA format
Chemical properties of sequence with tag

Notes

The start codon is a ATG/Methionine in most of sequences, but the GTG/V, TTG/L, CTG/I can be the start codons in some cases as expressing in E.coli. The start codon warning is labelled by RED color in sequence(sample: 10174951).

Protein sequence information contains the annotation contents from both of JCSG and SWISS-PROT. The SWISS-PROT/TrEMBL annotation is accessed from SWALL(SPTR) on the EBI SRS server. PDB homologes show both identical and highly similar proteins with released date and protein function.


Contact Webmaster JCSG Menu