LOADING...
   YP_001299520.1;GS13510A
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
YP_001299520.1    GS13510A            JCSG 385698 PDB Deposition 13-SEP-03              PDB id: 4mjf

Protein Sequence Information


TOPSAN
JCSG Internal annotations

ACCESSIONYP_001299520.1
DESCRIPTIONCASP Target
Description Hidden
ORGANISMBacteroides vulgatus atcc 8482
COMMENT 
DR UNIPROT; A6L2I4_BACV8
DR SPTR; A6L2I4 (flat text); A6L2I4 (good view)
DR GenBank; YP_001299520
DR PDB; 4MJF; Identical; 13-NOV-13; HYPOTHETICAL PROTEIN;
DR PDB; 3SBU; Highly similar; 13-JUL-11; HYPOTHETICAL NTF2-LIKE PROTEIN;
DR FFAS; 384353; Fold and function assignment.
DR TVPC; YP_001299520.1; Homologs in PDB, JCSG and SG center.
DR OVP; YP_001299520.1; Ortholog view popup.
DR TPM; YP_001299520.1; Target PDB monitor.
DR FSS; YP_001299520.1; Target function coverage.
PROPERTY Residues: 286 aa
Molecule Weight: 33487.29 Dalton
Isoelectric Point: 4.76
Extinction Coefficient: 42400
Gravy Index: -.52
Number of Met residues: 11
Percentage of Met residues: 3.85 %
Number of Cys residues: 2
Percentage of Cys residues: 0.70 %
SEQUENCE  amino acids 286 aa
>YP_001299520.1  gi|150004776|ref|YP_001299520.1| hypothetical protein BVU_2238 [Bacteroides vulgatus ATCC 8482]
MRKLIIGVCLLMLISSCGGGKKKMDPFETLTEEIDSLTAPPDTTEAMAAVEEEPMVPATA
DESFADFFYNFASDEKLQLSRIVFPLPYYTMEKKEHIEKDQWKHDPLFSRQDAYTVLFDK
AEDMEMEKDTGLTSVKIEWIYLKKGKIKRYYFERLKGLWKLEAIDFADMPREDTGKEDFF
EFYERFANDSVFQLSRLHEPLKFVTADPEDEFQILETTLEAGQWFAFQPVLPRENLTNVN
YGQNENVHSNTKVIEMKGFGNGFNNTLYFERRHGLWKLMQFEDLSD

CDS  cDNA 861 bp
   1 atgagaaaac taataatcgg agtttgtctg cttatgctga taagctcctg tggaggtgga    60
  61 aaaaagaaaa tggacccctt cgagacgctt actgaggaga ttgattcgct gactgcaccc   120
 121 ccggacacaa cagaagcgat ggctgcggta gaggaagaac caatggttcc cgctacggcc   180
 181 gacgaaagtt ttgccgactt tttctacaat tttgccagtg atgaaaagtt acaattgtca   240
 241 cgcatcgtgt tccctttgcc gtattataca atggaaaaga aagagcacat tgaaaaggac   300
 301 caatggaaac acgatccttt attcagccgg caagatgcct atacagttct gttcgataag   360
 361 gcggaagata tggaaatgga gaaagatacg gggcttacca gtgtcaagat agaatggatt   420
 421 tacttgaaga agggaaaaat caagcggtac tattttgagc gtctgaaggg gctgtggaaa   480
 481 ctggaagcca tagatttcgc ggatatgccg agagaggata ccggtaagga ggacttcttt   540
 541 gagttttatg aacgttttgc caatgattcg gttttccagt tgtcacgttt gcacgaaccg   600
 601 ttgaagtttg tgactgctga tcccgaagac gagtttcaga tactggaaac gactttggag   660
 661 gccggacaat ggttcgcatt ccagcctgtg ttgcctcgtg agaatctgac taatgtgaac   720
 721 tatggccaga acgagaatgt gcattccaat acgaaagtga ttgaaatgaa aggttttggc   780
 781 aatggattta ataatacgct ctattttgaa cggcggcacg gtctatggaa actgatgcag   840
 841 tttgaggatc tgagcgattg a   861
Target constructs
Download sequence in PIR or FASTA format
Chemical properties of sequence with tag

Notes

The start codon is a ATG/Methionine in most of sequences, but the GTG/V, TTG/L, CTG/I can be the start codons in some cases as expressing in E.coli. The start codon warning is labelled by RED color in sequence(sample: 10174951).

Protein sequence information contains the annotation contents from both of JCSG and SWISS-PROT. The SWISS-PROT/TrEMBL annotation is accessed from SWALL(SPTR) on the EBI SRS server. PDB homologes show both identical and highly similar proteins with released date and protein function.


Contact Webmaster JCSG Menu