LOADING...
   YP_001298566.1;GS7807N
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
YP_001298566.1    GS7807N            JCSG 385643 PDB Deposition 13-JUN-26              PDB id: 4ler

Protein Sequence Information


TOPSAN
JCSG Internal annotations

ACCESSIONYP_001298566.1
DESCRIPTIONCASP Target
Description Hidden
ORGANISMBacteroides vulgatus atcc 8482
COMMENT 
DR UNIPROT; A6KZT0_BACV8
DR SPTR; A6KZT0 (flat text); A6KZT0 (good view)
DR GenBank; YP_001298566
DR PDB; 4LER; Identical; 10-JUL-13; PUTATIVE OUTER MEMBRANE PROTEIN, PROBABLY INVOLVE NUTRIENT B;
DR PDB; 3EJN; Highly similar; 30-SEP-08; SUSD HOMOLOG;
DR PDB; 3MX3; Highly similar; 07-JUL-10; SUSD HOMOLOG;
DR FFAS; 384461; Fold and function assignment.
DR TVPC; YP_001298566.1; Homologs in PDB, JCSG and SG center.
DR OVP; YP_001298566.1; Ortholog view popup.
DR TPM; YP_001298566.1; Target PDB monitor.
DR FSS; YP_001298566.1; Target function coverage.
PROPERTY Residues: 493 aa
Molecule Weight: 55505.07 Dalton
Isoelectric Point: 4.65
Extinction Coefficient: 95120
Gravy Index: -.4
Number of Met residues: 13
Percentage of Met residues: 2.64 %
Number of Cys residues: 3
Percentage of Cys residues: 0.61 %
SEQUENCE  amino acids 493 aa
>YP_001298566.1  gi|150003822|ref|YP_001298566.1| putative outer membrane protein, probably involved in nutrient bind
MKKYIKYMASLLAVSFAMSACIDLEEMNVDPNNATTTNPSLLLTGVAYSAFNQTSSDACH
AAKMLILTSGESKYQVYKWTRGDFDYYSNLRDVTKMSEEAGEGSAYQALAHFFRANYFYQ
LTLDFGSIPYTDALKAETDANYQPAYDSQEVVLAGILKELEEADKMLEGSDEIISGDIIY
NGNLVNWRKLINAYRLRILMSLSGKEKVGDIDVKSEFSKIVADGPLMESLSDNGQLIYLD
QQDNRYPYFNDSDFGSGRFMDSTYIAELATRQDPRLFAVATQTPNAEKAGKAINDFSSYD
GGDPAVPYSLVNDKAVAGNCSKPAPRYYQTPTNEPMVLLGYVEQQLILAEAVVRGWIQGD
DKIYYESAVKASFEFYQKYAVSVADYLTQDAAAEYLRNDKVAYSSSLSTDEKIERIIMQK
YLPTFLQGSVWLPYYEALRTGYPDFRRAAGVSLPYRWMYPQDEYNNNATHVEAALNEQFG
GSDKTSDKPWWLQ

CDS  cDNA 1482 bp
   1 atgaagaagt atatcaaata catggcatct cttcttgccg tatcctttgc aatgagtgct    60
  61 tgcattgatt tggaagagat gaatgtggat cctaataatg ccactactac caatccttcc   120
 121 ctgttgttga ccggagttgc ttatagtgct ttcaatcaaa ccagttcgga tgcttgccat   180
 181 gcagccaaga tgctgattct gacttcggga gaaagcaagt atcaggttta taaatggacg   240
 241 cgtggggatt ttgattatta tagcaatttg cgtgatgtga ccaaaatgtc agaagaggcc   300
 301 ggagaaggaa gtgcttatca ggctttggct catttcttcc gtgccaatta tttctatcag   360
 361 ttgactctgg actttggaag tatcccctat acggatgcgc ttaaggcaga aacagatgcg   420
 421 aattaccagc cggcatacga ttcgcaggaa gttgtgctgg ccggcatttt gaaggaactg   480
 481 gaagaggccg ataaaatgct tgaaggcagt gatgagatta tttcgggaga tattatctac   540
 541 aatggcaact tggttaattg gagaaaattg attaatgctt accgcttacg tattttgatg   600
 601 tctttgtcgg gaaaagagaa ggtaggtgat atagatgtta aatcggagtt ttcaaagatt   660
 661 gtagccgacg gacctttaat ggaaagcttg tcggataacg ggcagttgat ctatcttgac   720
 721 cagcaggata accgttatcc gtattttaat gacagcgatt tcggttcggg gcgttttatg   780
 781 gattccactt atattgctga attggctaca cggcaggatc cgcgtttatt tgctgttgcc   840
 841 acgcaaactc cgaatgctga aaaagccgga aaagcgatta atgatttcag ctcttatgac   900
 901 gggggtgatc cggctgttcc ttatagtttg gttaatgata aggcggtggc tggaaactgt   960
 961 tccaagcctg ctccccgtta ttaccagact ccgaccaatg agcctatggt cttgttaggt  1020
1021 tacgttgaac agcagcttat attggctgag gctgtagtaa gaggatggat tcagggagat  1080
1081 gacaagattt attatgaatc ggccgtcaag gcgtcttttg agttttatca gaaatatgct  1140
1141 gtgtcggtag ctgattatct cactcaggat gcagcggcag aataccttcg aaatgacaag  1200
1201 gtggcttatt cctcttccct ttctactgat gagaagatag agcgtattat tatgcaaaag  1260
1261 tatttgccga catttttgca gggaagtgta tggctaccct actatgaggc gcttcgtacg  1320
1321 gggtatcccg atttccgccg tgccgcagga gttagtctgc cttatcgctg gatgtatccg  1380
1381 caggatgaat ataataacaa tgccactcat gtggaggctg ctttgaatga gcagtttggt  1440
1441 ggaagtgata aaacctcgga taagccttgg tggttgcagt aa  1482
Target constructs
Download sequence in PIR or FASTA format
Chemical properties of sequence with tag

Notes

The start codon is a ATG/Methionine in most of sequences, but the GTG/V, TTG/L, CTG/I can be the start codons in some cases as expressing in E.coli. The start codon warning is labelled by RED color in sequence(sample: 10174951).

Protein sequence information contains the annotation contents from both of JCSG and SWISS-PROT. The SWISS-PROT/TrEMBL annotation is accessed from SWALL(SPTR) on the EBI SRS server. PDB homologes show both identical and highly similar proteins with released date and protein function.


Contact Webmaster JCSG Menu