LOADING...
   YP_001298518.1;SP13588M
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
YP_001298518.1    SP13588M            JCSG 419456 PDB Deposition 14-SEP-02              PDB id: 4r8o

Protein Sequence Information


TOPSAN
JCSG Internal annotations

ACCESSIONYP_001298518.1
DESCRIPTIONCASP Target
Description Hidden
ORGANISMBacteroides vulgatus atcc 8482
COMMENT 
DR UNIPROT;
DR SPTR;
DR GenBank;
DR PDB; 4R8O; Identical; 17-SEP-14; UNCHARACTERIZED PROTEIN;
DR FFAS; 409815; Fold and function assignment.
DR TVPC; YP_001298518.1; Homologs in PDB, JCSG and SG center.
DR OVP; YP_001298518.1; Ortholog view popup.
DR TPM; YP_001298518.1; Target PDB monitor.
DR FSS; YP_001298518.1; Target function coverage.
PROPERTY Residues: 128 aa
Molecule Weight: 15045.59 Dalton
Isoelectric Point: 8.87
Extinction Coefficient: 29910
Gravy Index: -.61
Number of Met residues: 8
Percentage of Met residues: 6.25 %
Number of Cys residues: 1
Percentage of Cys residues: 0.78 %
SEQUENCE  amino acids 128 aa
>YP_001298518.1  gi|150003774|ref|YP_001298518.1| hypothetical protein BVU_1206 [Bacteroides vulgatus ATCC 8482]
MKKINFLKGMLVVAILFIANLTVFAGNPGDNLIYNAEEVNGVVVSETIFKMEGTMLTNYM
KHNYKYDANNQRTEDEAQKWNSNKNRWENNLCIRYTYGNKSMTTEYYKWNSKKKEYILVP
EMTVTMDK

CDS  cDNA 387 bp
   1 atgaaaaaga tcaatttttt gaaaggaatg ctcgttgtag caattttatt tattgctaac    60
  61 cttacagttt ttgcaggaaa tccgggtgac aacctgattt acaatgcaga agaagtaaat   120
 121 ggagtagttg tttcggaaac gatttttaaa atggaaggca ccatgcttac taattatatg   180
 181 aagcacaatt acaagtatga cgccaacaac caacgtactg aggacgaggc gcaaaaatgg   240
 241 aacagtaaca aaaaccgctg ggaaaataac ctctgcattc gttatactta tggcaataaa   300
 301 agtatgacta ctgaatatta caaatggaac tctaaaaaga aagaatatat attagtaccc   360
 361 gaaatgaccg taactatgga caaataa   387
Target constructs
Download sequence in PIR or FASTA format
Chemical properties of sequence with tag

Notes

The start codon is a ATG/Methionine in most of sequences, but the GTG/V, TTG/L, CTG/I can be the start codons in some cases as expressing in E.coli. The start codon warning is labelled by RED color in sequence(sample: 10174951).

Protein sequence information contains the annotation contents from both of JCSG and SWISS-PROT. The SWISS-PROT/TrEMBL annotation is accessed from SWALL(SPTR) on the EBI SRS server. PDB homologes show both identical and highly similar proteins with released date and protein function.


Contact Webmaster JCSG Menu