LOADING...
   YP_001298242.1;YP_001298242.1
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
YP_001298242.1    GS13171A            JCSG 425030 PDB Deposition 14-JUN-18

Protein Sequence Information


TOPSAN
JCSG Internal annotations

ACCESSIONYP_001298242.1
DESCRIPTIONCASP Target
Description Hidden
ORGANISMBacteroides vulgatus atcc 8482
COMMENT 
DR UNIPROT; A6KYV6_BACV8
DR SPTR; A6KYV6 (flat text); A6KYV6 (good view)
DR GenBank; YP_001298242
DR PDB; 2MQC; Identical; 03-SEP-14; UNCHARACTERIZED PROTEIN;
DR FFAS; 384314; Fold and function assignment.
DR TVPC; YP_001298242.1; Homologs in PDB, JCSG and SG center.
DR OVP; YP_001298242.1; Ortholog view popup.
DR TPM; YP_001298242.1; Target PDB monitor.
DR FSS; YP_001298242.1; Target function coverage.
PROPERTY Residues: 529 aa
Molecule Weight: 57481.45 Dalton
Isoelectric Point: 5.23
Extinction Coefficient: 80220
Gravy Index: -.4
Number of Met residues: 7
Percentage of Met residues: 1.32 %
Number of Cys residues: 5
Percentage of Cys residues: 0.95 %
SEQUENCE  amino acids 529 aa
>YP_001298242.1  gi|150003498|ref|YP_001298242.1| hypothetical protein BVU_0925 [Bacteroides vulgatus ATCC 8482]
MVKSITTIICGFLVLLSVSSCRKEQEEPCPENGRVTFTVAQTRATQEGTFEKGNSIGVFA
IEPKTGVYWATNNKYTYDGRAFKPATEEDNIIVTVGTDLDFYVYYPFKEGQTDITAISHA
IGDQQEKSGWLSADFLTASYTDVIQDYTIPLHFEHRLSTVEVRVEGSDRVDGARMENVKY
GSRFNLLTGKTVTDETRGSYAMYRYSSGNLTTVFRMTIPAQTLTTTSNYITLTGTPDMKL
RGTSDMTTEPGRIHNYRIDYKIRITVLDYPQGGSTTGAGLYDMGSTCTVTASVNGGYEFA
GWYEDGRIVSNDTRYSFEVLSDRTLEPRYRNYGGWSVTLTANPSVIGWQGGRSSLVAGAS
RGVFVNGVAENTQTAVPSLSGGAEGFLLSGNTVTVSENPSGSSRSCVFTASHGGSSATAT
ITQEGSPVSYYFSYADGGTSHTEYPDDSSAGSFILDITSYKKTGNSTKALSWNASGDSWI
HVNGSSVSYDENPAKERRTGLVTLKQDESGKTLSLKIVQPGKTSIDIEQ

CDS  cDNA 1590 bp
   1 atggtaaaat caataacaac gataatctgc ggcttccttg tcctgctgtc cgtatcctcc    60
  61 tgccggaagg aacaggagga gccatgcccg gaaaacggcc gtgtcacctt taccgtcgcc   120
 121 caaacgcgtg ccacccagga aggcacgttc gaaaagggaa actccatagg cgtatttgcc   180
 181 atcgagccca agaccggcgt gtactgggcc acaaataaca aatacaccta tgacggccgg   240
 241 gcattcaaac ccgcaacgga agaggacaac atcattgtga cggtggggac cgatcttgac   300
 301 ttctatgtat attatccttt caaggagggg cagacagaca tcaccgccat atcccatgcc   360
 361 ataggagacc agcaggaaaa gtccggatgg ctttcagccg atttcctgac agcgtcctat   420
 421 acggacgtaa tacaggacta tacgataccg ctgcatttcg agcaccggct gtcgaccgtg   480
 481 gaggtccggg tggaaggaag cgaccgcgtg gacggcgccc gtatggaaaa tgtgaaatac   540
 541 ggcagccggt tcaacctgct taccggaaaa accgttacgg acgagaccag gggaagctat   600
 601 gctatgtaca ggtacagttc cgggaacctc accacggtat tccggatgac catacccgcc   660
 661 cagaccctta cgacaacctc caattacata accctcacag gaaccccgga catgaagctg   720
 721 cgcggcactt ccgacatgac caccgaaccc ggcagaatcc acaactaccg gatagattac   780
 781 aagatacgga taaccgtcct tgactatccg cagggtggaa gcaccacagg tgcgggcctg   840
 841 tacgacatgg gaagcacctg cacggtcacc gcgtccgtga acggcggtta tgagttcgca   900
 901 ggatggtacg aggacggcag gatcgtgtcg aatgacacac ggtacagttt cgaggtactg   960
 961 tcggaccgta cactcgagcc caggtaccgt aattatggcg gctggtcggt caccctgacg  1020
1021 gcaaatccct ccgtcatcgg ctggcagggc ggcagatctt cccttgtggc gggagcctca  1080
1081 cgcggagtgt tcgtcaacgg agtggcagaa aacacacaga cggctgtccc ctccctcagc  1140
1141 ggaggagcag aaggattcct cctttcaggg aatacggtga cagtgtcgga aaacccgtca  1200
1201 ggctcatccc ggagctgtgt gtttacggca agtcacggag gaagctcggc cacggccaca  1260
1261 atcacccagg agggatctcc ggtaagctat tatttcagct atgcggatgg cggaaccagc  1320
1321 cataccgaat atccggacga ctcatcggcc ggctcattca ttttggacat aacaagttac  1380
1381 aagaagacgg gcaactctac aaaagccctt tcctggaacg catccggtga cagctggatt  1440
1441 catgtgaacg gctcatcggt aagctatgac gagaatccgg caaaggaaag gaggaccggt  1500
1501 cttgtgaccc tcaaacagga tgaaagcggc aaaacgctgt cattgaaaat tgtacagccg  1560
1561 ggaaagactt ccattgacat cgaacaataa  1590
Target constructs
Download sequence in PIR or FASTA format
Chemical properties of sequence with tag

Notes

The start codon is a ATG/Methionine in most of sequences, but the GTG/V, TTG/L, CTG/I can be the start codons in some cases as expressing in E.coli. The start codon warning is labelled by RED color in sequence(sample: 10174951).

Protein sequence information contains the annotation contents from both of JCSG and SWISS-PROT. The SWISS-PROT/TrEMBL annotation is accessed from SWALL(SPTR) on the EBI SRS server. PDB homologes show both identical and highly similar proteins with released date and protein function.


Contact Webmaster JCSG Menu