LOADING...
   YP_001297703.1;SP0950A
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
YP_001297703.1    SP0950A            JCSG 418078 PDB Deposition 13-OCT-02              PDB id: 4n0r

Protein Sequence Information


TOPSAN
JCSG Internal annotations

ACCESSIONYP_001297703.1
DESCRIPTIONCASP Target
Description Hidden
ORGANISMBacteroides vulgatus atcc 8482
COMMENT 
DR UNIPROT;
DR SPTR;
DR GenBank;
DR PDB; 4N0R; Identical; 23-OCT-13; PUTATIVE GLYCOSIDE HYDROLASE;
DR FFAS; 409761; Fold and function assignment.
DR TVPC; YP_001297703.1; Homologs in PDB, JCSG and SG center.
DR OVP; YP_001297703.1; Ortholog view popup.
DR TPM; YP_001297703.1; Target PDB monitor.
DR FSS; YP_001297703.1; Target function coverage.
PROPERTY Residues: 534 aa
Molecule Weight: 61891.65 Dalton
Isoelectric Point: 7.59
Extinction Coefficient: 129720
Gravy Index: -.39
Number of Met residues: 14
Percentage of Met residues: 2.62 %
Number of Cys residues: 7
Percentage of Cys residues: 1.31 %
SEQUENCE  amino acids 534 aa
>YP_001297703.1  gi|150002959|ref|YP_001297703.1| hypothetical protein BVU_0362 [Bacteroides vulgatus ATCC 8482]
MSTKFYVIAVWTLLSFVVKVNAQDKVECWDRFELSFKQVTKGNPFDIRLSATFVCGKEKK
TVEGFYDGENTYRIRFMPAVAGEWRYVTSSSIGAMNGRKGTFTVIPAGKDNHGMVLVDGE
HNFKYADGTRYYPMGTTAYAWTHMKETTQEATLKSFGEAGFNKVRMCVFPKNYSLVKDEP
ALYPFEIEKTIKDKEGNERKEWDFDRFDPAFFQHLEKRIDQLNRLGIEADLILFHPYDKG
RWGFDAMSNEVNVRYIKYITARLASFRNVWWSMANEWDYVKAKTVDDWKLLTKTVVENDP
YRHLCSIHGATATYFDYWMPEFTHVSIQDEAPVLSSTASATLRKIYRKPVICDEVGYEGN
LPYRWGRLSPQQMTCFILNGLLGGIYVTHGECYQQGNEPIFWAQGGSLKGESWKRVKFLR
TIIEAAPHPLEMADISRDLVTSTAGPDYYLVNMGKDVKGFWTFNLPVKNADYNKLQKNKR
FKVEIIDVWAMTVTEYPVIFETTEELDYRVFDIHHRGVRIPDAPYIVLRITEVK

CDS  cDNA 1605 bp
   1 atgagtacaa aattttatgt aatagctgtt tggacgctgt taagttttgt ggtaaaagta    60
  61 aatgcacaag acaaagtgga atgttgggac cggtttgagt tgagttttaa acaggtgacc   120
 121 aaagggaatc cttttgatat acgtctttcc gctactttcg tttgtggaaa ggaaaagaaa   180
 181 acggtggaag gattttatga tggtgagaat acttatagga tacggtttat gcctgctgtc   240
 241 gccggggaat ggaggtatgt tacatcttcc agtatagggg ctatgaatgg tcggaaaggt   300
 301 acattcacag tgatacctgc cggaaaagat aatcatggca tggtattggt ggacggagaa   360
 361 cataatttta aatatgcgga cggtacccgt tattatccga tgggtacgac ggcctatgca   420
 421 tggacacata tgaaggaaac gactcaggag gctactttga aatcgtttgg tgaagccggt   480
 481 tttaataagg taaggatgtg tgtgtttcct aaaaactatt ctttagtgaa agacgagcct   540
 541 gcgctttatc cttttgaaat agagaagacg ataaaagata aggaaggaaa tgaaaggaaa   600
 601 gaatgggact ttgacagatt tgacccggct ttttttcagc atttggagaa acggatagac   660
 661 caactgaacc gtttggggat tgaggcggat ttgatccttt tccatcctta tgataaggga   720
 721 agatggggct ttgatgctat gtcgaatgag gtgaatgtac gttatattaa atatattact   780
 781 gctcgtttgg cttcttttag aaatgtatgg tggtctatgg caaacgagtg ggattatgta   840
 841 aaagcgaaaa ctgtggacga ttggaagctg ttgacgaaaa ctgtggttga gaatgatcct   900
 901 tatcgccatt tatgttctat tcatggagcg acggctactt attttgatta ttggatgcct   960
 961 gaatttaccc atgtcagcat acaggatgag gcaccggtac tgagttctac cgcttctgct  1020
1021 actttaagaa aaatttatcg caaaccggtt atatgtgatg aggttgggta tgaagggaat  1080
1081 ctaccttatc gttggggaag gttaagtccg cagcagatga cttgctttat tttgaatggt  1140
1141 ttgttgggtg gaatttatgt cactcacggt gaatgttatc agcaggggaa cgaacctatc  1200
1201 ttttgggcgc aagggggatc tttaaaaggt gaaagctgga aacgtgtgaa atttttaaga  1260
1261 acgattattg aagctgctcc ccatccgttg gagatggcag atatcagtcg tgacttggtt  1320
1321 acttctactg ctggaccaga ttattatctg gtcaatatgg gaaaagatgt gaaaggtttc  1380
1381 tggactttta atctgccggt aaaaaatgcg gattataaca aattgcaaaa gaataaacgg  1440
1441 tttaaagtgg agattattga tgtgtgggcc atgactgtca cggaatatcc tgtgatattt  1500
1501 gaaacaacgg aggaattgga ttatcgtgtt tttgatatac atcatcgggg agtaagaatt  1560
1561 ccggatgctc cttatattgt tcttagaata acagaagtga aatga  1605
Target constructs
Download sequence in PIR or FASTA format
Chemical properties of sequence with tag

Notes

The start codon is a ATG/Methionine in most of sequences, but the GTG/V, TTG/L, CTG/I can be the start codons in some cases as expressing in E.coli. The start codon warning is labelled by RED color in sequence(sample: 10174951).

Protein sequence information contains the annotation contents from both of JCSG and SWISS-PROT. The SWISS-PROT/TrEMBL annotation is accessed from SWALL(SPTR) on the EBI SRS server. PDB homologes show both identical and highly similar proteins with released date and protein function.


Contact Webmaster JCSG Menu