LOADING...
   YP_001297591.1;GS13522A
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
YP_001297591.1    GS13522A            JCSG 393205 PDB Deposition 11-MAY-17              PDB id: 3s30

Protein Sequence Information


TOPSAN
JCSG Internal annotations

ACCESSIONYP_001297591.1
DESCRIPTIONPutative glycoside hydrolase, galactose-binding domain-like
ORGANISMBacteroides vulgatus atcc 8482
COMMENTFold: Galactose-binding domain-like (according to topsan of pdb 3hbz)

FATCAT/DALI top hit PUTATIVE GLYCOSIDE HYDROLASE (Pdb 3hbzA, Z-score 25.4, rmsd 1.8, P-value 1.61e-10)

HHpred, against Pfam, PF12891 Glyco_hydro_44 - family of putative bacterial glycoside hydrolases - (PF12891, prob 100.0, E-val 0)
DR UNIPROT; A6KX05_BACV8
DR SPTR; A6KX05 (flat text); A6KX05 (good view)
DR GenBank; YP_001297591
DR PDB; 3S30; Identical; 08-JUN-11; HYPOTHETICAL GLYCOSIDE HYDROLASE;
DR PDB; 3HBZ; Highly similar; 26-MAY-09; PUTATIVE GLYCOSIDE HYDROLASE;
DR PDB; 4HET; Highly similar; 24-OCT-12; HYPOTHETICAL GLYCOSIDE HYDROLASE;
DR PDB; 4JRL; Highly similar; 24-APR-13; PUTATIVE GLYCOSIDE HYDROLASE;
DR KEGG; 3.2.-; Enzyme page
DR FFAS; 384365; Fold and function assignment.
DR TVPC; YP_001297591.1; Homologs in PDB, JCSG and SG center.
DR OVP; YP_001297591.1; Ortholog view popup.
DR TPM; YP_001297591.1; Target PDB monitor.
DR FSS; YP_001297591.1; Target function coverage.
PROPERTY Residues: 382 aa
Molecule Weight: 42377.17 Dalton
Isoelectric Point: 4.92
Extinction Coefficient: 53750
Gravy Index: -.34
Number of Met residues: 6
Percentage of Met residues: 1.57 %
Number of Cys residues: 6
Percentage of Cys residues: 1.57 %
SEQUENCE  amino acids 382 aa
>YP_001297591.1  gi|150002847|ref|YP_001297591.1| hypothetical protein BVU_0247 [Bacteroides vulgatus ATCC 8482]
MKLKNLFTCTVTGLLLCTSCIKDEAPNAEADILNCILPAEMLTGTDIDYNRPYDKSLNAY
PIYIEVNNGTDLTRLAPTFELTEGASIEPANGSTQNFTNPVRYTVTSEDKNWHRTYAINI
HYPETKSIPTVFNFENVKTVPYNKNEYYVLYEAASGYSTLTWSSGNQGFALTGSGYTPND
FPTSISPNGRTGNCLQLITRKTGSLGTLVGMPIAAGNLFIGSFDIGSAMSDALSATKFGT
TFYYEPIKLVGYYKYKAGPEFYENGESTNRKDVFNIYALFYEKTKDVQMLDGHIAKNNYE
HENMVAAAVITDTHETSEWTRFELDFNYEHYGKTIDPQKLANGGYNVSIVLSASKDGDVF
QGAPGSTLLIDDLELVCKQPLR

CDS  cDNA 1149 bp
   1 atgaagctga aaaacttatt cacctgcaca gtaacaggat tgctcctttg cacctcctgt    60
  61 atcaaggacg aagcccccaa tgcggaagcg gacatcttga actgcatcct ccctgccgag   120
 121 atgctgacag gtacagacat tgactataac cgtccttacg acaaaagcct gaacgcttac   180
 181 cctatttaca tagaagtaaa caacggtacc gacctgaccc gactagctcc cactttcgag   240
 241 ctgactgaag gagcatctat cgaaccggcc aacggaagta cacagaattt caccaaccca   300
 301 gtgcgctata ccgtaacatc cgaggacaag aattggcacc gcacctacgc catcaatatc   360
 361 cattatccag aaaccaaaag catcccgacg gtttttaact ttgaaaacgt aaaaaccgta   420
 421 ccttacaata aaaatgaata ttatgtgcta tacgaagcag cctctggcta ctccacacta   480
 481 acatggtcca gtggtaatca gggatttgcc ttaaccggaa gcggttacac tccgaacgac   540
 541 ttccctacca gcatcagtcc aaacggccgc acaggcaact gcttgcaact gattactcgc   600
 601 aaaacaggaa gtttaggcac tttggtaggt atgcccattg cagcaggtaa cctgttcatt   660
 661 ggcagtttcg acataggctc cgccatgagc gatgcgttgt cggcaaccaa attcggaaca   720
 721 accttctatt atgaacccat taaattggtc ggctactaca aatacaaagc aggaccagaa   780
 781 ttctatgaga acggagaatc taccaaccga aaagacgttt tcaatatcta tgccttgttt   840
 841 tacgaaaaga ccaaagacgt gcagatgctg gatggccata tcgcaaagaa caattatgaa   900
 901 catgaaaaca tggtagccgc tgctgtcata accgacacgc atgaaacaag cgaatggacc   960
 961 cgctttgaac tggacttcaa ctatgagcat tatggaaaaa caatagatcc ccaaaaattg  1020
1021 gcaaacggag gatacaacgt cagcattgtc ctatcggcaa gcaaggacgg tgatgtattt  1080
1081 caaggcgcac cgggtagcac cctgcttatt gacgacctgg aactggtatg caaacaacca  1140
1141 cttagataa  1149
Target constructs
Download sequence in PIR or FASTA format
Chemical properties of sequence with tag

Notes

The start codon is a ATG/Methionine in most of sequences, but the GTG/V, TTG/L, CTG/I can be the start codons in some cases as expressing in E.coli. The start codon warning is labelled by RED color in sequence(sample: 10174951).

Protein sequence information contains the annotation contents from both of JCSG and SWISS-PROT. The SWISS-PROT/TrEMBL annotation is accessed from SWALL(SPTR) on the EBI SRS server. PDB homologes show both identical and highly similar proteins with released date and protein function.


Contact Webmaster JCSG Menu