LOADING...
   YP_001270669.1;SP18870A
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
YP_001270669.1    SP18870A            JCSG 430688 PDB Deposition 14-JUN-18              PDB id: 2mqd

Protein Sequence Information


TOPSAN
JCSG Internal annotations

ACCESSIONYP_001270669.1
DESCRIPTIONCASP Target
Description Hidden
ORGANISMLactobacillus reuteri dsm 20016
COMMENT 
DR UNIPROT;
DR SPTR;
DR GenBank;
DR PDB; 2MQD; Identical; 03-SEP-14; UNCHARACTERIZED PROTEIN;
DR FFAS; 411973; Fold and function assignment.
DR TVPC; YP_001270669.1; Homologs in PDB, JCSG and SG center.
DR OVP; YP_001270669.1; Ortholog view popup.
DR TPM; YP_001270669.1; Target PDB monitor.
DR FSS; YP_001270669.1; Target function coverage.
PROPERTY Residues: 160 aa
Molecule Weight: 17994.7 Dalton
Isoelectric Point: 9.16
Extinction Coefficient: 19940
Gravy Index: -.27
Number of Met residues: 1
Percentage of Met residues: 0.62 %
Number of Cys residues: 1
Percentage of Cys residues: 0.62 %
SEQUENCE  amino acids 160 aa
>YP_001270669.1  gi|148543299|ref|YP_001270669.1| hypothetical protein Lreu_0056 [Lactobacillus reuteri DSM 20016]
MKRKVIITIIILISCLWVAVTINFNRPSSQQVQDETQSSQQPRPKFTDQQIGVLAGLAIS
PEWLKQNIAANQLVYGIVKPSDTVPAGVDDYSYLVAADDQDGTIIFFKAEGQTVIIKYTS
QRNTKLKAKALTLSQLKKEFYQTRSQKREVDDYVAGLRTE

CDS  cDNA 483 bp
   1 atgaaaagaa aagtaattat aacaatcatt attttaatta gttgcttatg ggtggcagtt    60
  61 acaattaact ttaatcggcc ttcctctcag caagttcagg atgaaacaca gtcaagtcaa   120
 121 cagccacggc caaaatttac cgaccaacaa attggggttt tagcgggatt ggcaatatct   180
 181 cccgagtggt taaaacaaaa tattgctgca aatcaactcg tttatggaat tgttaagccc   240
 241 tctgacaccg ttccagcagg ggtagatgat tatagttatt tagtagccgc tgacgaccaa   300
 301 gatgggacga taattttctt taaagcggaa ggacaaaccg tgattataaa atatacttct   360
 361 cagcgaaata caaaactaaa agcaaaggcc ttaaccttat cgcaattaaa aaaagaattt   420
 421 taccaaacta ggtcacaaaa aagagaagta gacgactacg tagcaggatt gcggaccgaa   480
 481 taa   483
Target constructs
Download sequence in PIR or FASTA format
Chemical properties of sequence with tag

Notes

The start codon is a ATG/Methionine in most of sequences, but the GTG/V, TTG/L, CTG/I can be the start codons in some cases as expressing in E.coli. The start codon warning is labelled by RED color in sequence(sample: 10174951).

Protein sequence information contains the annotation contents from both of JCSG and SWISS-PROT. The SWISS-PROT/TrEMBL annotation is accessed from SWALL(SPTR) on the EBI SRS server. PDB homologes show both identical and highly similar proteins with released date and protein function.


Contact Webmaster JCSG Menu