LOADING...
   YP_001088154.1;SP17422AN
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
YP_001088154.1    SP17422AN            JCSG 418088 PDB Deposition 14-FEB-13              PDB id: 4ote

Protein Sequence Information


TOPSAN
JCSG Internal annotations

ACCESSIONYP_001088154.1
DESCRIPTIONCASP Target
Description Hidden
ORGANISMClostridium difficile 630
COMMENT 
DR UNIPROT;
DR SPTR;
DR GenBank;
DR Pfam; PF03180; Lipoprotein_9;
DR PDB; 4OTE; Identical; 19-MAR-14; LIPOPROTEIN;
DR PDB; 4YAH; Highly similar; 08-APR-15; D-METHIONINE-BINDING LIPOPROTEIN METQ;
DR PDB; 4QHQ; Highly similar; 18-JUN-14; LIPOPROTEIN;
DR PDB; 4K3F; Highly similar; 24-APR-13; PROBABLE TONB-DEPENDENT RECEPTOR;
DR PDB; 4EF1; Highly similar; 25-APR-12; PHEROMONE COB1/LIPOPROTEIN, YAEC FAMILY;
DR PDB; 4EF2; Highly similar; 25-APR-12; PHEROMONE COB1/LIPOPROTEIN, YAEC FAMILY;
DR PDB; 4GOT; Highly similar; 10-OCT-12; METHIONINE-BINDING LIPOPROTEIN METQ;
DR PDB; 3TQW; Highly similar; 21-SEP-11; METHIONINE-BINDING PROTEIN;
DR FFAS; 410011; Fold and function assignment.
DR TVPC; YP_001088154.1; Homologs in PDB, JCSG and SG center.
DR OVP; YP_001088154.1; Ortholog view popup.
DR TPM; YP_001088154.1; Target PDB monitor.
DR FSS; YP_001088154.1; Target function coverage.
PROPERTY Residues: 265 aa
Molecule Weight: 29220.45 Dalton
Isoelectric Point: 7.49
Extinction Coefficient: 17880
Gravy Index: -.1
Number of Met residues: 2
Percentage of Met residues: 0.75 %
Number of Cys residues: 5
Percentage of Cys residues: 1.89 %
SEQUENCE  amino acids 265 aa
>YP_001088154.1  gi|126699257|ref|YP_001088154.1| putative lipoprotein [Clostridium difficile 630]
MKFKKLLCLLLCLVLTLAVVGCSKAKDDKKIVVGATLVPGGELLEELKPLIKEKGYTLEV
KNFDDYILPNEALNNGEIDANLFQHEPYLKEAVKAKGYKIMAGKKLYVCPAILYSYKIKS
VDEFKKGDTIAISNNPSSCSKNLRYLESIGLLTLPKGDGLVSPKDIIENPKGIQFKELDI
AQIPSSLPDVTAAFIDTTYAVPAGLDAKKNGIYTAPINDEYANLLAFRTEDKDSEKIKVL
QDVLTSDKARSLIEEKYKGIVIPTF

CDS  cDNA 798 bp
   1 atgaaattca aaaaattatt atgtttgtta ttatgtctag tattaacttt agctgtggtt    60
  61 ggatgttcta aagctaaaga tgataaaaaa attgttgttg gtgctacttt agttccagga   120
 121 ggagagttat tagaagaatt aaaaccactt attaaagaaa aaggatatac tttagaagtt   180
 181 aaaaactttg atgattacat acttccaaac gaagctttaa ataatggtga aattgatgca   240
 241 aatctatttc aacatgaacc ttatctaaaa gaagctgtta aggccaaagg ttacaaaata   300
 301 atggctggta aaaaactata tgtatgccca gcaatacttt actcttataa gataaaatct   360
 361 gttgatgaat ttaaaaaagg agatacaatt gcaataagca ataacccatc ttcttgttct   420
 421 aagaacctta gataccttga aagtattgga cttttaacgt tacctaaagg ggatggatta   480
 481 gttagtccta aggacataat agaaaatcca aagggaatac aattcaaaga gttagatatt   540
 541 gctcaaattc catcttctct tccagatgtg actgctgcat ttatagatac tacttatgct   600
 601 gtacctgctg gtcttgatgc caagaaaaac ggaatttata cagctcctat aaatgacgag   660
 661 tatgcaaatc ttttagcatt tagaactgaa gataaagaca gtgaaaagat taaagttcta   720
 721 caagatgttc ttacatcaga taaagcaaga agcttaattg aagaaaaata caaaggtatt   780
 781 gtgattccta ctttttag   798
Target constructs
Download sequence in PIR or FASTA format
Chemical properties of sequence with tag

Notes

The start codon is a ATG/Methionine in most of sequences, but the GTG/V, TTG/L, CTG/I can be the start codons in some cases as expressing in E.coli. The start codon warning is labelled by RED color in sequence(sample: 10174951).

Protein sequence information contains the annotation contents from both of JCSG and SWISS-PROT. The SWISS-PROT/TrEMBL annotation is accessed from SWALL(SPTR) on the EBI SRS server. PDB homologes show both identical and highly similar proteins with released date and protein function.


Contact Webmaster JCSG Menu