LOADING...
   YP_001087438.1;SP19352A
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
YP_001087438.1    SP19352A            JCSG 418108 PDB Deposition 15-JUN-08              PDB id: 5bxg

Protein Sequence Information


TOPSAN
JCSG Internal annotations

ACCESSIONYP_001087438.1
DESCRIPTIONCASP Target
Description Hidden
ORGANISMClostridium difficile 630
COMMENT 
DR UNIPROT;
DR SPTR;
DR GenBank;
DR FFAS; 410058; Fold and function assignment.
DR TVPC; YP_001087438.1; Homologs in PDB, JCSG and SG center.
DR OVP; YP_001087438.1; Ortholog view popup.
DR TPM; YP_001087438.1; Target PDB monitor.
DR FSS; YP_001087438.1; Target function coverage.
PROPERTY Residues: 186 aa
Molecule Weight: 21114.9 Dalton
Isoelectric Point: 4.85
Extinction Coefficient: 14900
Gravy Index: -.42
Number of Met residues: 3
Percentage of Met residues: 1.61 %
Number of Cys residues: 5
Percentage of Cys residues: 2.69 %
SEQUENCE  amino acids 186 aa
>YP_001087438.1  gi|126698541|ref|YP_001087438.1| putative phage lipoprotein [Clostridium difficile 630]
MKKKVCFLFSILIVICLAIVGCSNSESPEESSKNNEPKKEEKKDKEVVIGEKIISDKMEI
TINNIEFSYDVLPKVKESLYTHYPAESGKVYIDIAADIKNTQKQELNCSDLLTIEANYND
GYKYSSQTIVEDETTGFTYDNISSIDPLETKGVRFIIDCPDEVKTSDKPVILSFTFDGNK
YVYKMK

CDS  cDNA 561 bp
   1 atgaagaaaa aagtatgttt tttattttct attcttatag ttatctgttt agctattgta    60
  61 ggatgttcta attcagaaag tccagaggag agtagtaaaa ataatgaacc aaaaaaagaa   120
 121 gaaaaaaagg ataaagaagt agtcatagga gagaaaatta tttcagataa aatggaaatc   180
 181 actattaata atattgaatt ctcttatgat gttttaccaa aggttaagga aagtttatat   240
 241 acacattatc ctgctgagtc aggcaaagta tatattgata ttgctgctga tataaaaaat   300
 301 actcaaaaac aagagttaaa ttgttcagat ttactaacta ttgaagcaaa ttataatgat   360
 361 gggtataaat attcatcaca aacaatagta gaagatgaaa ccacaggttt tacttatgat   420
 421 aatatttcta gtattgaccc tttagaaaca aagggagtta gatttataat cgattgccct   480
 481 gatgaagtaa aaacaagtga taagccagta atattaagtt ttacatttga tgggaataag   540
 541 tatgtttata aaatgaagta a   561
Target constructs
Download sequence in PIR or FASTA format
Chemical properties of sequence with tag

Notes

The start codon is a ATG/Methionine in most of sequences, but the GTG/V, TTG/L, CTG/I can be the start codons in some cases as expressing in E.coli. The start codon warning is labelled by RED color in sequence(sample: 10174951).

Protein sequence information contains the annotation contents from both of JCSG and SWISS-PROT. The SWISS-PROT/TrEMBL annotation is accessed from SWALL(SPTR) on the EBI SRS server. PDB homologes show both identical and highly similar proteins with released date and protein function.


Contact Webmaster JCSG Menu