LOADING...
   TM1828;TM1828
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
TM1828    TM1828            JCSG 283681 PDB Deposition 06-AUG-04              PDB id: 2hxv

Protein Sequence Information


TOPSAN
JCSG Internal annotations

ACCESSIONTM1828
DESCRIPTIONDiaminohydroxyphosphoribosylaminopyrimidine deaminase (EC 3.5.4.26) / 5-amino-6-
(5-phosphoribosylamino)uracil reductase (EC 1.1.1.193)
ORGANISMThermotoga maritima
COMMENTSubsystem: Riboflavin biosynthesis
Conserved cluster of genes: TM1825-1828
Fusion of two catalytic domains: consecutive steps of the pathway
DR UNIPROT; Q9X2E8_THEMA
DR SPTR; Q9X2E8 (flat text); Q9X2E8 (good view)
DR GenBank; AAD36891
DR Pfam; PF00383; dCMP_cyt_deam_1;
DR Pfam; PF01872; RibD_C;
DR Interpro; IPR002125; dCMP/cyt_deam;
DR Interpro; IPR004794; Eubact_ribD;
DR Interpro; IPR002734; RibD_C;
DR PDB; 2HXV; Identical; 15-AUG-06; DIAMINOHYDROXYPHOSPHORIBOSYLAMINOPYRIMIDINE DEAMI AMINO-6-(5;
DR PDB; 2B3Z; Highly similar; 29-NOV-05; RIBOFLAVIN BIOSYNTHESIS PROTEIN RIBD;
DR PDB; 2D5N; Highly similar; 29-NOV-05; RIBOFLAVIN BIOSYNTHESIS PROTEIN RIBD;
DR PDB; 3EX8; Highly similar; 04-NOV-08; RIBOFLAVIN BIOSYNTHESIS PROTEIN RIBD;
DR PDB; 4G3M; Highly similar; 20-FEB-13; RIBOFLAVIN BIOSYNTHESIS PROTEIN RIBD;
DR PDB; 2O7P; Highly similar; 13-FEB-07; RIBOFLAVIN BIOSYNTHESIS PROTEIN RIBD;
DR PDB; 2G6V; Highly similar; 06-FEB-07; RIBOFLAVIN BIOSYNTHESIS PROTEIN RIBD;
DR PDB; 2OBC; Highly similar; 13-FEB-07; RIBOFLAVIN BIOSYNTHESIS PROTEIN RIBD;
DR KEGG; 3.5.4.26; Enzyme page
DR FFAS; 283681; Fold and function assignment.
DR TVPC; TM1828; Homologs in PDB, JCSG and SG center.
DR OVP; TM1828; Ortholog view popup.
DR TPM; TM1828; Target PDB monitor.
DR FSS; TM1828; Target function coverage.
PROPERTY Residues: 348 aa
Molecule Weight: 38863.68 Dalton
Isoelectric Point: 6.78
Extinction Coefficient: 18910
Gravy Index: -.22
Number of Met residues: 5
Percentage of Met residues: 1.44 %
Number of Cys residues: 6
Percentage of Cys residues: 1.72 %
SEQUENCE  amino acids 348 aa
>TM1828  TM1828 riboflavin-specific deaminase (ribD)
MYETFMKRAIELAKKGLGRVNPNPPVGAVVVKDGRIIAEGFHPYFGGPHAERMAIESARK
KGEDLRGATLIVTLEPCDHHGKTPPCTDLIIESGIKTVVIGTRDPNPVSGNGVEKFRNHG
IEVIEGVLEEEVKKLCEFFITYVTKKRPFVALKYASTLDGKIADHRGDSKWITDKLRFKV
HEMRNIYSAVLVGAGTVLKDNPQLTCRLKEGRNPVRVILDRKGVLSGKVFRVFEENARVI
VFTESEEAEYPPHVEKALSDCSVESILRNLYERDIDSVLVEGGSKVFSEFLDHADVVFGF
YSTKIFGKGLDVFSGYLSDVSVPPKFKVVNVEFSDSEFLVEMRPCSRE

CDS  cDNA 1044 bp
   1 atgtatgaaa ctttcatgaa aagagcgata gagcttgcaa agaaaggact tggaagggtg    60
  61 aatcccaacc caccagttgg tgcggtcgtt gtgaaagacg gcaggataat cgcggagggt   120
 121 tttcatccct attttggagg tccgcacgct gaaaggatgg caatagaaag tgcaagaaag   180
 181 aaaggagaag atttacgagg tgcaactctc atagttaccc ttgaaccctg tgatcatcat   240
 241 ggaaagacac ctccatgcac ggatctgatc atagaaagtg gaataaaaac cgttgtgatt   300
 301 ggaacaaggg atccaaatcc tgtttcggga aacggtgtgg aaaaattcag aaatcacggt   360
 361 attgaagtga tagaaggtgt tttggaagaa gaggtgaaaa agctgtgtga gtttttcatc   420
 421 acttatgtga caaagaaaag gccgttcgtt gcgctgaagt acgcgtccac cttagatggg   480
 481 aaaatagctg atcacagagg agattccaag tggatcacag acaaactcag attcaaggtt   540
 541 cacgagatga gaaacatcta ctctgctgtt ctcgtcggtg ctggaacggt tttgaaggac   600
 601 aatcctcagc taacctgcag actgaaagaa ggcagaaatc ctgtgagggt gatcctcgac   660
 661 agaaagggtg ttttgagtgg gaaagtgttc agagtgttcg aagaaaacgc tcgggtgatc   720
 721 gttttcacag aaagtgaaga ggcggaatat ccaccacacg tggagaaggc cctgagcgat   780
 781 tgttctgtgg agagtatatt gagaaatctg tatgaaaggg atatcgattc tgtcttggtg   840
 841 gaaggcggat cgaaggtgtt cagtgaattt ttggatcacg cagatgtggt ttttggtttt   900
 901 tattcgacga agattttcgg aaaggggctt gatgtcttct ccggttatct gtcagatgtt   960
 961 tcggttcctc cgaagttcaa agtggtgaac gtggagtttt ccgattcgga gtttctggtg  1020
1021 gagatgagac cgtgttcacg ggaa  1044
Target constructs
Download sequence in PIR or FASTA format
Chemical properties of sequence with tag
GENE PREDICTION
LEFT END RIGHT END FRAME PREDICTOR SCORE 
1803065 1804111 -2 Glimmer3 score 14.54 good
Genemark probabilities .86   .89 good
GenemarkHMM class 1 good

Notes

The start codon is a ATG/Methionine in most of sequences, but the GTG/V, TTG/L, CTG/I can be the start codons in some cases as expressing in E.coli. The start codon warning is labelled by RED color in sequence(sample: 10174951).

Protein sequence information contains the annotation contents from both of JCSG and SWISS-PROT. The SWISS-PROT/TrEMBL annotation is accessed from SWALL(SPTR) on the EBI SRS server. PDB homologes show both identical and highly similar proteins with released date and protein function.


Contact Webmaster JCSG Menu