LOADING...
   TM1816;TM1816
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
TM1816    TM1816            JCSG 283669 PDB Deposition 04-APR-27              PDB id: 1t3v, 1o13

Protein Sequence Information


TOPSAN
JCSG Internal annotations

ACCESSIONTM1816
DESCRIPTIONPutative dinitrogenase iron-molybdenum cofactor [Ribonuclease H-like motif]
ORGANISMThermotoga maritima
COMMENT 
DR UNIPROT; Q9X2D6_THEMA
DR SPTR; Q9X2D6 (flat text); Q9X2D6 (good view)
DR GenBank; AAD36879
DR Pfam; PF02579; Nitro_FeMo-Co;
DR Interpro; IPR003731; DUF153;
DR PDB; 1T3V; Identical; 14-DEC-04; CONSERVED HYPOTHETICAL PROTEIN;
DR PDB; 1O13; Identical; 18-DEC-02; PROBABLE NIFB PROTEIN;
DR PDB; 2YX6; Highly similar; 30-OCT-07; HYPOTHETICAL PROTEIN PH0822;
DR PDB; 1RDU; Highly similar; 06-JUL-04; CONSERVED HYPOTHETICAL PROTEIN;
DR PDB; 1EO1; Highly similar; 20-DEC-00; HYPOTHETICAL PROTEIN MTH1175;
DR FFAS; 283669; Fold and function assignment.
DR TVPC; TM1816; Homologs in PDB, JCSG and SG center.
DR OVP; TM1816; Ortholog view popup.
DR TPM; TM1816; Target PDB monitor.
DR FSS; TM1816; Target function coverage.
PROPERTY Residues: 124 aa
Molecule Weight: 13624.7 Dalton
Isoelectric Point: 6.18
Extinction Coefficient: 4470
Gravy Index: -.3
Number of Met residues: 2
Percentage of Met residues: 1.61 %
Number of Cys residues: 0
Percentage of Cys residues: 0.00 %
SEQUENCE  amino acids 124 aa
>TM1816  TM1816 conserved hypothetical protein
MIIAIPVSENRGKDSPISEHFGRAPYFAFVKVKNNAIADISVEENPLAQDHVHGAVPNFV
KEKGAELVIVRGIGRRAIAAFEAMGVKVIKGASGTVEEVVNQYLSGQLKDSDYEVHDHHH
HEHH

CDS  cDNA 372 bp
   1 atgatcatag ccattcccgt ctccgaaaac agaggaaaag attctcccat atcggaacac    60
  61 ttcggtaggg caccgtattt cgcattcgtg aaggtgaaga acaacgcgat agcggatatc   120
 121 agtgttgaag aaaaccctct tgcacaggat catgttcacg gtgctgtccc aaattttgtg   180
 181 aaagaaaaag gagcggagct ggtgatagtg agaggtatcg gaagaagagc catcgctgcc   240
 241 ttcgaagcca tgggtgtaaa agtgataaag ggcgcatcag gaacagtgga agaagtggtg   300
 301 aaccagtatc tctcaggaca actgaaagat tcagactacg aagttcacga tcatcaccac   360
 361 cacgaacatc ac   372
Target constructs
Download sequence in PIR or FASTA format
Chemical properties of sequence with tag
GENE PREDICTION
LEFT END RIGHT END FRAME PREDICTOR SCORE 
1791991 1792365 1 Glimmer3 score 12.51 good
Genemark probabilities .87   .96 good
GenemarkHMM class 1 good

Notes

The start codon is a ATG/Methionine in most of sequences, but the GTG/V, TTG/L, CTG/I can be the start codons in some cases as expressing in E.coli. The start codon warning is labelled by RED color in sequence(sample: 10174951).

Protein sequence information contains the annotation contents from both of JCSG and SWISS-PROT. The SWISS-PROT/TrEMBL annotation is accessed from SWALL(SPTR) on the EBI SRS server. PDB homologes show both identical and highly similar proteins with released date and protein function.


Contact Webmaster JCSG Menu