LOADING...
   TM1785;TM1785
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
TM1785    TM1785            JCSG 283638 PDB Deposition 07-FEB-02              PDB id: 2ord

Protein Sequence Information


TOPSAN
JCSG Internal annotations

ACCESSIONTM1785
DESCRIPTIONAcetylornithine aminotransferase (EC 2.6.1.11) (ACOAT).
ORGANISMThermotoga maritima
COMMENTGenome and functional context strongly supportive: on a chromosome this gene belongs to a conservative cluster (TM1780 - TM1785) of Arginine Biosynthesis genes.
--------------------------------------------------------------------------
-!- CATALYTIC ACTIVITY: N(2)-ACETYL-L-ORNITHINE + 2-OXOGLUTARATE = N-
ACETYL-L-GLUTAMATE 5-SEMIALDEHYDE + L-GLUTAMATE.
-!- COFACTOR: PYRIDOXAL PHOSPHATE (BY SIMILARITY).
-!- PATHWAY: ARGININE BIOSYNTHESIS; FOURTH STEP.
-!- SUBCELLULAR LOCATION: CYTOPLASMIC (PROBABLE).
-!- MISCELLANEOUS: MAY ALSO HAVE SUCCINYLDIAMINOPIMELATE
AMINOTRANSFERASE ACTIVITY, THUS CARRYING OUT THE FOURTH STEP IN
LYSINE BIOSYNTHESIS.
-!- SIMILARITY: BELONGS TO CLASS-III OF PYRIDOXAL-PHOSPHATE-DEPENDENT
AMINOTRANSFERASES.
--------------------------------------------------------------------------
This SWISS-PROT entry is copyright. It is produced through a collaboration
between the Swiss Institute of Bioinformatics and the EMBL outstation -
the European Bioinformatics Institute. There are no restrictions on its
use by non-profit institutions as long as its content is in no way
modified and this statement is not removed. Usage by and for commercial
entities requires a license agreement (See http://www.isb-sib.ch/announce/
or send an email to license@isb-sib.ch).
--------------------------------------------------------------------------
DR UNIPROT; ARGD_THEMA
DR SPTR; Q9X2A5 (flat text); Q9X2A5 (good view)
DR GenBank; AAD36848
DR Pfam; PF00202; Aminotran_3;
DR Interpro; IPR005814; Aminotrans_3;
DR Interpro; IPR004636; ArgD_aminotrans;
DR PDB; 2E54; Identical; 19-JUN-07; ACETYLORNITHINE AMINOTRANSFERASE;
DR PDB; 2ORD; Identical; 13-FEB-07; ACETYLORNITHINE AMINOTRANSFERASE;
DR PDB; 2EH6; Highly similar; 11-SEP-07; ACETYLORNITHINE AMINOTRANSFERASE;
DR PDB; 3NX3; Highly similar; 25-AUG-10; ACETYLORNITHINE AMINOTRANSFERASE;
DR PDB; 4JEV; Highly similar; 26-MAR-14; ACETYLORNITHINE/SUCCINYLDIAMINOPIMELATE AMINOTRAN CHAIN: A,;
DR PDB; 4JEW; Highly similar; 26-MAR-14; ACETYLORNITHINE/SUCCINYLDIAMINOPIMELATE AMINOTRAN CHAIN: A,;
DR PDB; 4JEX; Highly similar; 26-MAR-14; ACETYLORNITHINE/SUCCINYLDIAMINOPIMELATE AMINOTRAN CHAIN: A,;
DR PDB; 2PB0; Highly similar; 25-DEC-07; ACETYLORNITHINE/SUCCINYLDIAMINOPIMELATE AMINOTRAN CHAIN: A,;
DR KEGG; 2.6.1.11; Enzyme page
DR FFAS; 283638; Fold and function assignment.
DR TVPC; TM1785; Homologs in PDB, JCSG and SG center.
DR OVP; TM1785; Ortholog view popup.
DR TPM; TM1785; Target PDB monitor.
DR FSS; TM1785; Target function coverage.
PROPERTY Residues: 385 aa
Molecule Weight: 42882.08 Dalton
Isoelectric Point: 6
Extinction Coefficient: 33350
Gravy Index: -.24
Number of Met residues: 9
Percentage of Met residues: 2.34 %
Number of Cys residues: 6
Percentage of Cys residues: 1.56 %
SEQUENCE  amino acids 385 aa
>TM1785  TM1785 acetylornithine aminotransferase (argD)
MYLMNTYSRFPATFVYGKGSWIYDEKGNAYLDFTSGIAVNVLGHSHPRLVEAIKDQAEKL
IHCSNLFWNRPQMELAELLSKNTFGGKVFFANTGTEANEAAIKIARKYGKKKSEKKYRIL
SAHNSFHGRTLGSLTATGQPKYQKPFEPLVPGFEYFEFNNVEDLRRKMSEDVCAVFLEPI
QGESGIVPATKEFLEEARKLCDEYDALLVFDEVQCGMGRTGKLFAYQKYGVVPDVLTTAK
GLGGGVPIGAVIVNERANVLEPGDHGTTFGGNPLACRAGVTVIKELTKEGFLEEVEEKGN
YLMKKLQEMKEEYDVVADVRGMGLMIGIQFREEVSNREVATKCFENKLLVVPAGNNTIRF
LPPLTVEYGEIDLAVETLKKVLQGI

CDS  cDNA 1155 bp
   1 atgtatctga tgaacactta cagcaggttt ccagcaacgt ttgtctacgg taaaggctcc    60
  61 tggatctacg acgaaaaagg aaacgcgtat ctcgatttca cttcaggaat agcggtgaac   120
 121 gtcctcggac actctcatcc tcgactggtg gaggccataa aggatcaggc agagaagctc   180
 181 attcactgtt caaatctttt ctggaaccga ccgcagatgg aactggcaga gcttctgtcg   240
 241 aagaacacgt tcggtggcaa ggttttcttc gcgaacacgg gaaccgaagc gaacgaagcc   300
 301 gccataaaga tagcgagaaa atacggaaag aaaaagagcg aaaaaaaata cagaatcctc   360
 361 tccgcccaca attctttcca cggaagaact ctgggctccc tcacagcgac gggacagccg   420
 421 aaatatcaga aacctttcga accactcgtt cccggttttg aatacttcga gttcaacaac   480
 481 gtagaagatc tgagaagaaa gatgtcagaa gacgtgtgtg ctgtgttcct cgaaccgatt   540
 541 cagggagaaa gcggaatagt accagccacc aaagaattcc ttgaagaggc tagaaaacta   600
 601 tgcgacgagt acgatgcact tcttgtgttc gatgaggttc agtgtggaat gggaaggaca   660
 661 ggaaaactct tcgcgtatca aaagtacgga gtcgttccgg acgttctcac aaccgccaag   720
 721 ggactcggtg ggggagtccc cattggagct gtcatcgtga acgaaagagc aaatgttctg   780
 781 gagccgggag atcacggcac cacgttcgga ggaaacccgc tcgcctgcag ggccggggtg   840
 841 accgtgatca aagagttgac gaaggaaggc ttcctcgaag aagtggaaga gaagggaaac   900
 901 tacctcatga aaaagctcca ggaaatgaaa gaagaatacg acgtggtagc cgacgtgagg   960
 961 ggaatgggac tcatgatagg gattcagttt agagaggaag tgagcaacag agaggtcgcc  1020
1021 acgaaatgct ttgaaaataa actgctcgtc gttccagcag gtaacaacac aatcagattc  1080
1081 ttaccaccgc tcacggtaga gtacggagag atcgatctgg cagttgaaac gctcaaaaaa  1140
1141 gtcctgcaag gaatt  1155
Target constructs
Download sequence in PIR or FASTA format
Chemical properties of sequence with tag
GENE PREDICTION
LEFT END RIGHT END FRAME PREDICTOR SCORE 
1761533 1762690 2 Glimmer3 score 11.71 poor
Genemark probabilities .94   .97 good
GenemarkHMM class 1 good

Notes

The start codon is a ATG/Methionine in most of sequences, but the GTG/V, TTG/L, CTG/I can be the start codons in some cases as expressing in E.coli. The start codon warning is labelled by RED color in sequence(sample: 10174951).

Protein sequence information contains the annotation contents from both of JCSG and SWISS-PROT. The SWISS-PROT/TrEMBL annotation is accessed from SWALL(SPTR) on the EBI SRS server. PDB homologes show both identical and highly similar proteins with released date and protein function.


Contact Webmaster JCSG Menu