LOADING...
   TM1782;TM1782
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
TM1782    TM1782            JCSG 283635 PDB Deposition 04-JUN-11              PDB id: 1vkn

Protein Sequence Information


TOPSAN
JCSG Internal annotations

ACCESSIONTM1782
DESCRIPTIONN-acetyl-gamma-glutamyl-phosphate reductase (EC 1.2.1.38) (AGPR) (N- acetyl-glutamate semialdehyde dehydrogenase) (NAGSA dehydrogenase).
ORGANISMThermotoga maritima
COMMENTGenome and functional context strongly supportive: on a chromosome this gene belongs to a conservative cluster (TM1780 - TM1785) of Arginine Biosynthesis genes.
--------------------------------------------------------------------------
!- CATALYTIC ACTIVITY: N-ACETYL-L-GLUTAMATE 5-SEMIALDEHYDE + NADP(+)
+ PHOSPHATE = N-ACETYL-5-GLUTAMYL PHOSPHATE + NADPH.
-!- PATHWAY: ARGININE BIOSYNTHESIS; THIRD STEP.
-!- SUBCELLULAR LOCATION: CYTOPLASMIC (PROBABLE).
-!- SIMILARITY: BELONGS TO THE NAGSA DEHYDROGENASE FAMILY. SUBFAMILY
1.
--------------------------------------------------------------------------
This SWISS-PROT entry is copyright. It is produced through a collaboration
between the Swiss Institute of Bioinformatics and the EMBL outstation -
the European Bioinformatics Institute. There are no restrictions on its
use by non-profit institutions as long as its content is in no way
modified and this statement is not removed. Usage by and for commercial
entities requires a license agreement (See http://www.isb-sib.ch/announce/
or send an email to license@isb-sib.ch).
--------------------------------------------------------------------------
DR UNIPROT; ARGC_THEMA
DR SPTR; Q9X2A2 (flat text); Q9X2A2 (good view)
DR GenBank; AAD36845
DR Pfam; PF01118; Semialdhyde_dh;
DR Pfam; PF02774; Semialdhyde_dhC;
DR Interpro; IPR000706; AGPR_act_site;
DR Interpro; IPR000534; Semialdh_dh;
DR PDB; 1VKN; Identical; 22-JUN-04; N-ACETYL-GAMMA-GLUTAMYL-PHOSPHATE REDUCTASE;
DR PDB; 1XYG; Highly similar; 23-NOV-04; PUTATIVE N-ACETYL-GAMMA-GLUTAMYL-PHOSPHATE REDUCT CHAIN: A,;
DR PDB; 2Q49; Highly similar; 19-JUN-07; PROBABLE N-ACETYL-GAMMA-GLUTAMYL-PHOSPHATE REDUCT CHAIN: A,;
DR PDB; 2CVO; Highly similar; 06-DEC-05; PUTATIVE SEMIALDEHYDE DEHYDROGENASE;
DR PDB; 2I3A; Highly similar; 29-AUG-06; N-ACETYL-GAMMA-GLUTAMYL-PHOSPHATE REDUCTASE;
DR PDB; 2I3G; Highly similar; 05-SEP-06; N-ACETYL-GAMMA-GLUTAMYL-PHOSPHATE REDUCTASE;
DR PDB; 2NQT; Highly similar; 28-NOV-06; N-ACETYL-GAMMA-GLUTAMYL-PHOSPHATE REDUCTASE;
DR PDB; 2OZP; Highly similar; 28-AUG-07; N-ACETYL-GAMMA-GLUTAMYL-PHOSPHATE REDUCTASE;
DR KEGG; 1.2.1.38; Enzyme page
DR FFAS; 283635; Fold and function assignment.
DR TVPC; TM1782; Homologs in PDB, JCSG and SG center.
DR OVP; TM1782; Ortholog view popup.
DR TPM; TM1782; Target PDB monitor.
DR FSS; TM1782; Target function coverage.
PROPERTY Residues: 339 aa
Molecule Weight: 37933.69 Dalton
Isoelectric Point: 6.04
Extinction Coefficient: 36330
Gravy Index: -.21
Number of Met residues: 9
Percentage of Met residues: 2.65 %
Number of Cys residues: 3
Percentage of Cys residues: 0.88 %
SEQUENCE  amino acids 339 aa
>TM1782  TM1782 N-acetyl-gamma-glutamyl-phosphate reductase (argC)
MIRAGIIGATGYTGLELVRLLKNHPEAKITYLSSRTYAGKKLEEIFPSTLENSILSEFDP
EKVSKNCDVLFTALPAGASYDLVRELKGVKIIDLGADFRFDDPGVYREWYGKELSGYENI
KRVYGLPELHREEIKNAQVVGNPGCYPTSVILALAPALKHNLVDPETILVDAKSGVSGAG
RKEKVDYLFSEVNESLRPYNVAKHRHVPEMEQELGKISGKKVNVVFTPHLVPMTRGILST
IYVKTDKSLEEIHEAYLEFYKNEPFVHVLPMGIYPSTKWCYGSNHVFIGMQMEERTNTLI
LMSAIDNLVKGASGQAVQNMNIMFGLDETKGLEFTPIYP

CDS  cDNA 1017 bp
   1 ttgatcagag ctggaataat aggtgcgaca ggttacacag gactggagct cgtcagactt    60
  61 ttgaaaaacc accccgaagc gaagataacc tatctgtcct cgaggaccta cgccggaaag   120
 121 aaacttgaag aaatcttccc ttcgacactg gagaacagta ttctcagcga gttcgatcca   180
 181 gagaaggtct caaaaaactg cgatgttctt ttcacggcgc ttccagccgg tgcgagttac   240
 241 gatctcgtca gggagctcaa aggtgtgaag ataatagatc ttggcgcgga ttttcgtttc   300
 301 gacgacccgg gagtgtacag agagtggtac ggaaaagagt tgtcgggata cgagaacata   360
 361 aaaagagttt acggacttcc agaactccat cgtgaggaga taaagaatgc tcaggtggtg   420
 421 ggaaatcccg gatgttatcc aacgagcgtc atcctcgctc tcgctcccgc actgaaacac   480
 481 aatcttgtgg atccggaaac gatactggtc gacgcgaaat ctggagtttc cggggcggga   540
 541 agaaaagaga aggtagatta tctcttctcc gaggtgaacg aaagtctcag accgtacaac   600
 601 gtggcaaaac acagacacgt tcctgaaatg gagcaggaac tcgggaagat ctcggggaag   660
 661 aaagtgaacg tggtgttcac acctcatctc gttcctatga cgcgtggaat cctctcgacg   720
 721 atatacgtaa aaacagacaa atccctcgaa gagatacacg aagcgtacct cgaattctac   780
 781 aagaatgaac cgttcgttca tgttcttccc atgggaattt atccttcgac gaagtggtgc   840
 841 tatggatcca accacgtctt catcggtatg cagatggaag aaagaacaaa cacgctcata   900
 901 ctgatgagcg caatagacaa cctcgtgaag ggggcgtcgg gacaggcagt tcagaacatg   960
 961 aacatcatgt tcggtctgga cgagacgaag ggactcgaat tcactccaat atatccg  1017
Warning: the change of start codon from ATG/M to TTG/L;
Target constructs
Download sequence in PIR or FASTA format
Chemical properties of sequence with tag
GENE PREDICTION
LEFT END RIGHT END FRAME PREDICTOR SCORE 
1758456 1759475 3 Glimmer3 score 11.73 poor
Genemark probabilities -   - -
GenemarkHMM class 1 good

Notes

The start codon is a ATG/Methionine in most of sequences, but the GTG/V, TTG/L, CTG/I can be the start codons in some cases as expressing in E.coli. The start codon warning is labelled by RED color in sequence(sample: 10174951).

Protein sequence information contains the annotation contents from both of JCSG and SWISS-PROT. The SWISS-PROT/TrEMBL annotation is accessed from SWALL(SPTR) on the EBI SRS server. PDB homologes show both identical and highly similar proteins with released date and protein function.


Contact Webmaster JCSG Menu