LOADING...
   TM1780;TM1780
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
TM1780    TM1780            JCSG 283634 PDB Deposition 04-JUL-08              PDB id: 1vl2

Protein Sequence Information


TOPSAN
JCSG Internal annotations

ACCESSIONTM1780
DESCRIPTIONArgininosuccinate synthase (EC 6.3.4.5) (Citrulline--aspartate ligase).
ORGANISMThermotoga maritima
COMMENTGenome and functional context strongly supportive: on a chromosome this gene belongs to a conservative cluster (TM1780 - TM1785) of Arginine Biosynthesis genes.
-----------------------------------------------------------------------
-!- CATALYTIC ACTIVITY: ATP + L-CITRULLINE + L-ASPARTATE = AMP +
DIPHOSPHATE + L-ARGININOSUCCINATE.
-!- PATHWAY: ARGININE BIOSYNTHESIS; SEVENTH STEP.
-!- SUBUNIT: HOMOTETRAMER (BY SIMILARITY).
-!- SUBCELLULAR LOCATION: CYTOPLASMIC (PROBABLE).
-!- SIMILARITY: BELONGS TO THE ARGININOSUCCINATE SYNTHASE FAMILY.
SUBFAMILY 1.
--------------------------------------------------------------------------
This SWISS-PROT entry is copyright. It is produced through a collaboration
between the Swiss Institute of Bioinformatics and the EMBL outstation -
the European Bioinformatics Institute. There are no restrictions on its
use by non-profit institutions as long as its content is in no way
modified and this statement is not removed. Usage by and for commercial
entities requires a license agreement (See http://www.isb-sib.ch/announce/
or send an email to license@isb-sib.ch).
--------------------------------------------------------------------------
DR UNIPROT; ASSY_THEMA
DR SPTR; Q9X2A1 (flat text); Q9X2A1 (good view)
DR GenBank; AAD36844
DR Pfam; PF00764; Arginosuc_synth;
DR Interpro; IPR001518; Arginosuc_synth;
DR PDB; 1VL2; Identical; 17-AUG-04; ARGININOSUCCINATE SYNTHASE;
DR PDB; 2NZ2; Highly similar; 05-DEC-06; ARGININOSUCCINATE SYNTHASE;
DR PDB; 1KH1; Highly similar; 03-APR-02; ARGININOSUCCINATE SYNTHETASE;
DR PDB; 1KH2; Highly similar; 03-APR-02; ARGININOSUCCINATE SYNTHETASE;
DR PDB; 1KOR; Highly similar; 03-APR-02; ARGININOSUCCINATE SYNTHETASE;
DR PDB; 1J1Z; Highly similar; 22-APR-03; ARGININOSUCCINATE SYNTHETASE;
DR PDB; 1J20; Highly similar; 22-APR-03; ARGININOSUCCINATE SYNTHETASE;
DR PDB; 1J21; Highly similar; 22-APR-03; ARGININOSUCCINATE SYNTHETASE;
DR KEGG; 6.3.4.5; Enzyme page
DR FFAS; 283634; Fold and function assignment.
DR TVPC; TM1780; Homologs in PDB, JCSG and SG center.
DR OVP; TM1780; Ortholog view popup.
DR TPM; TM1780; Target PDB monitor.
DR FSS; TM1780; Target function coverage.
PROPERTY Residues: 409 aa
Molecule Weight: 46051.53 Dalton
Isoelectric Point: 5.94
Extinction Coefficient: 54320
Gravy Index: -.28
Number of Met residues: 11
Percentage of Met residues: 2.69 %
Number of Cys residues: 1
Percentage of Cys residues: 0.24 %
SEQUENCE  amino acids 409 aa
>TM1780  TM1780 argininosuccinate synthase (argG)
MKEKVVLAYSGGLDTSVILKWLCEKGFDVIAYVANVGQKDDFVAIKEKALKTGASKVYVE
DLRREFVTDYIFTALLGNAMYEGRYLLGTAIARPLIAKRQVEIAEKEGAQYVAHGATGKG
NDQVRFELTYAALNPNLKVISPWKDPEFLAKFKGRTDLINYAMEKGIPIKVSKKRPYSED
ENLMHISHEAGKLEDPAHIPDEDVFTWTVSPKDAPDEETLLEIHFENGIPVKVVNLKDGT
EKTDPLELFEYLNEVGAKNGVGRLDMVENRFIGIKSRGVYETPGATILWIAHRDLEGITM
DKEVMHLRDMLAPKFAELIYNGFWFSPEMEFLLAAFRKAQENVTGKVTVSIYKGNVMPVA
RYSPYSLYNPELSSMDVEGGFDATDSKGFINIHALRLKVHQLVKKGYQR

CDS  cDNA 1227 bp
   1 atgaaagaga aagtcgttct tgcatacagt ggtggtctcg atacttccgt cattttgaag    60
  61 tggctctgcg aaaagggctt cgacgtgata gcttacgttg caaacgttgg acagaaggac   120
 121 gatttcgttg caataaaaga aaaggccttg aaaacaggcg cttcaaaagt ctacgtggaa   180
 181 gacctcagaa gggaattcgt cacagattac atattcaccg cactccttgg aaacgccatg   240
 241 tacgaaggaa ggtaccttct tggaaccgct atcgcaagac ctctcatagc caaaagacag   300
 301 gtggagatag ccgagaaaga aggagcacag tacgttgcgc acggtgcgac cgggaaagga   360
 361 aacgaccagg tgaggttcga gctcacctac gccgctttga atccaaatct caaagttatc   420
 421 tcaccctgga aagaccctga atttctcgcc aaattcaagg gcagaacaga tctcataaac   480
 481 tacgccatgg agaaagggat tccaatcaaa gtctccaaaa aaagacccta cagcgaagac   540
 541 gaaaacctca tgcacatttc ccacgaagcg ggcaaactgg aggatcccgc acacatacct   600
 601 gacgaagacg tgttcacatg gacagtctcc ccaaaggacg ctccggatga agaaaccttg   660
 661 ctcgagatcc atttcgaaaa cggcattccg gtgaaagttg tgaacctcaa agatggaaca   720
 721 gaaaagacag atcccctcga actcttcgaa tatctgaacg aagtaggtgc gaaaaatgga   780
 781 gtgggaagac tcgacatggt cgaaaacaga ttcataggta taaaatcaag aggggtgtac   840
 841 gaaactccgg gcgcgacgat cctgtggatc gcacacagag atctcgaagg aatcaccatg   900
 901 gacaaagaag tcatgcacct gagagacatg ctcgctccga agttcgcgga gctcatatac   960
 961 aacggtttct ggttttctcc agaaatggag ttcctcctcg cagcgttcag aaaagcacag  1020
1021 gagaacgtga ccggaaaggt gacggtatcc atatacaaag gaaacgtcat gcccgttgcg  1080
1081 aggtattcac cgtattcact gtacaatccg gaactttcga gcatggacgt cgaaggagga  1140
1141 ttcgatgcca ctgactcgaa gggcttcatc aacattcacg ccctgaggtt gaaggtccac  1200
1201 cagctcgtga aaaaggggta tcagaga  1227
Target constructs
Download sequence in PIR or FASTA format
Chemical properties of sequence with tag
GENE PREDICTION
LEFT END RIGHT END FRAME PREDICTOR SCORE 
1756038 1757267 3 Glimmer3 score 14.17 good
Genemark probabilities .95   .96 good
GenemarkHMM class 1 good

Notes

The start codon is a ATG/Methionine in most of sequences, but the GTG/V, TTG/L, CTG/I can be the start codons in some cases as expressing in E.coli. The start codon warning is labelled by RED color in sequence(sample: 10174951).

Protein sequence information contains the annotation contents from both of JCSG and SWISS-PROT. The SWISS-PROT/TrEMBL annotation is accessed from SWALL(SPTR) on the EBI SRS server. PDB homologes show both identical and highly similar proteins with released date and protein function.


Contact Webmaster JCSG Menu