LOADING...
   TM1766;TM1766
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
TM1766    TM1766            JCSG 283620 PDB Deposition 08-JUL-03              PDB id: 3do6

Protein Sequence Information


TOPSAN
JCSG Internal annotations

ACCESSIONTM1766
DESCRIPTIONPutative Formyltetrahydrofolate Synthetase
ORGANISMThermotoga maritima
COMMENT 
DR UNIPROT; FTHS_THEMA
DR SPTR; Q9X287 (flat text); Q9X287 (good view)
DR GenBank; AAD36830
DR Pfam; PF01268; FTHFS;
DR Interpro; IPR000559; Fmtethyd_synth;
DR PDB; 3DO6; Identical; 02-SEP-08; FORMATE--TETRAHYDROFOLATE LIGASE;
DR PDB; 4JIM; Highly similar; 20-MAR-13; FORMATE--TETRAHYDROFOLATE LIGASE;
DR PDB; 4JJK; Highly similar; 20-MAR-13; FORMATE--TETRAHYDROFOLATE LIGASE;
DR PDB; 4JJZ; Highly similar; 20-MAR-13; FORMATE--TETRAHYDROFOLATE LIGASE;
DR PDB; 4JKI; Highly similar; 20-MAR-13; FORMATE--TETRAHYDROFOLATE LIGASE;
DR PDB; 4IOJ; Highly similar; 10-APR-13; FORMATE--TETRAHYDROFOLATE LIGASE;
DR PDB; 4IOK; Highly similar; 10-APR-13; FORMATE--TETRAHYDROFOLATE LIGASE;
DR PDB; 4IOL; Highly similar; 10-APR-13; FORMATE--TETRAHYDROFOLATE LIGASE;
DR FFAS; 283620; Fold and function assignment.
DR TVPC; TM1766; Homologs in PDB, JCSG and SG center.
DR OVP; TM1766; Ortholog view popup.
DR TPM; TM1766; Target PDB monitor.
DR FSS; TM1766; Target function coverage.
PROPERTY Residues: 542 aa
Molecule Weight: 58534.35 Dalton
Isoelectric Point: 6.97
Extinction Coefficient: 21890
Gravy Index: -.03
Number of Met residues: 13
Percentage of Met residues: 2.40 %
Number of Cys residues: 2
Percentage of Cys residues: 0.37 %
SEQUENCE  amino acids 542 aa
>TM1766  TM1766 formate--tetrahydrofolate ligase (fhs)
MKPIKEIADQLELKDDILYPYGHYIAKIDHRFLKSLENHEDGKLILVTAVTPTPAGEGKT
TTSIGLSMSLNRIGKKSIVTLREPSLGPTLGLKGGATGGGRSRVLPSDEINLHFTGDMHA
VASAHNLLAAVLDSHIKHGNELKIDITRVFWKRTMDMNDRALRSIVIGLGGSANGFPRED
SFIITAASEVMAILALSENMKDLKERLGKIIVALDADRKIVRISDLGIQGAMAVLLKDAI
NPNLVQTTEGTPALIHCGPFANIAHGTNSIIATKMAMKLSEYTVTEAGFGADLGAEKFID
FVSRVGGFYPNAAVLVATVRALKYHGGANLKNIHEENLEALKEGFKNLRVHVENLRKFNL
PVVVALNRFSTDTEKEIAYVVKECEKLGVRVAVSEVFKKGSEGGVELAKAVAEAAKDVEP
AYLYEMNDPVEKKIEILAKEIYRAGRVEFSDTAKNALKFIKKHGFDELPVIVAKTPKSIS
HDPSLRGAPEGYTFVVSDLFVSAGAGFVVALSGDINLMPGLPKKPNALNMDVDDSGNIVG
VS

CDS  cDNA 1626 bp
   1 ttgaaaccga tcaaagagat cgccgatcag ttggaattga aagatgacat tctctatcct    60
  61 tacggccact acatagcgaa gatcgaccac agattcttga aaagccttga aaatcatgaa   120
 121 gatgggaaac tgatcctcgt aacggcagtt acccccaccc ctgcaggtga aggaaaaact   180
 181 accaccagca taggactttc catgtctctg aacagaatcg gtaagaaatc gatagttact   240
 241 ctgagagagc cttccctcgg ccccaccctt ggattgaaag gcggtgcaac aggaggtggc   300
 301 aggtcgaggg ttcttccttc tgatgagata aaccttcatt tcaccggaga tatgcacgcc   360
 361 gtggcctccg cccacaatct gctggcggcc gttctggact cgcacataaa acacggcaac   420
 421 gagctcaaaa tagacataac aagagtattc tggaagcgaa ccatggacat gaacgaccgt   480
 481 gctttgagaa gcatagtgat cggtcttgga ggctcagcga acggatttcc aagagaggac   540
 541 agtttcatca tcacggccgc ttccgaagtg atggccattc ttgctctgtc cgagaacatg   600
 601 aaggacctga aagaaagact tgggaaaata atcgtggcgc tcgacgctga cagaaaaatc   660
 661 gtcaggatct ctgatcttgg aatccagggt gccatggccg ttcttttgaa agatgccata   720
 721 aatcccaacc tcgttcagac aaccgaagga actccagcgc tcatacattg cggacctttc   780
 781 gccaacatcg cgcacggcac caattccatc atagcgacga agatggccat gaagctctcc   840
 841 gaatacacgg tcacggaggc gggttttgga gcagacctcg gtgctgagaa attcatcgac   900
 901 tttgtttccc gtgttggtgg tttttatccg aacgcagccg ttctggtggc cacagtgcga   960
 961 gctttgaagt accatggtgg tgcaaacctc aaaaacatcc acgaggaaaa cctggaagcc  1020
1021 ctcaaagaag gattcaaaaa tctcagggta cacgtggaaa acctgaggaa attcaatctg  1080
1081 cccgtcgtgg tagcgctgaa cagattcagc acggacacag aaaaggaaat agcctacgtg  1140
1141 gtgaaagagt gcgaaaaact cggtgtgagg gtagcagtca gtgaggtttt taaaaagggc  1200
1201 agcgaaggcg gtgtcgaact cgcaaaagcc gtagcagaag ctgcgaagga cgtagaaccg  1260
1261 gcttacctct acgagatgaa cgatcctgtg gaaaagaaga tagagattct cgcaaaagaa  1320
1321 atctacagag cgggaagagt ggagttttcc gatactgcaa aaaatgccct caaattcatt  1380
1381 aaaaaacacg gttttgatga gcttcccgtg atcgttgcca aaactccaaa gtccatttcc  1440
1441 cacgatccgt ctctcagagg tgcacctgaa ggatacacgt tcgttgtcag cgacctcttc  1500
1501 gtttccgccg gggcaggctt tgttgttgcg ctttcaggag acataaatct gatgcctggt  1560
1561 cttccaaaaa aaccaaatgc tttgaacatg gacgtagacg acagcggtaa catagtaggt  1620
1621 gtttcg  1626
Warning: the change of start codon from ATG/M to TTG/L;
Target constructs
Download sequence in PIR or FASTA format
Chemical properties of sequence with tag
GENE PREDICTION
LEFT END RIGHT END FRAME PREDICTOR SCORE 
1742057 1743685 2 Glimmer3 score 13.23 good
Genemark probabilities -   - -
GenemarkHMM class 1 good

Notes

The start codon is a ATG/Methionine in most of sequences, but the GTG/V, TTG/L, CTG/I can be the start codons in some cases as expressing in E.coli. The start codon warning is labelled by RED color in sequence(sample: 10174951).

Protein sequence information contains the annotation contents from both of JCSG and SWISS-PROT. The SWISS-PROT/TrEMBL annotation is accessed from SWALL(SPTR) on the EBI SRS server. PDB homologes show both identical and highly similar proteins with released date and protein function.


Contact Webmaster JCSG Menu