LOADING...
   TM1752;TM1752
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
TM1752    TM1752            JCSG 359798 PDB Deposition 04-APR-08              PDB id: 1vjz

Protein Sequence Information


TOPSAN
JCSG Internal annotations

ACCESSIONTM1752
DESCRIPTIONEndoglucanase.
ORGANISMThermotoga maritima
COMMENT 
DR UNIPROT; Q9X274_THEMA
DR SPTR; Q9X274 (flat text); Q9X274 (good view)
DR GenBank; AAD36817
DR Interpro; IPR001547; Glyco_hydro_5;
DR PDB; 1VJZ; Identical; 13-APR-04; ENDOGLUCANASE;
DR PDB; 3W0K; Highly similar; 20-FEB-13; BIFUNCTIONAL ENDOMANNANASE/ENDOGLUCANASE;
DR FFAS; 283607; Fold and function assignment.
DR TVPC; TM1752; Homologs in PDB, JCSG and SG center.
DR OVP; TM1752; Ortholog view popup.
DR TPM; TM1752; Target PDB monitor.
DR FSS; TM1752; Target function coverage.
PROPERTY Residues: 329 aa
Molecule Weight: 39298.98 Dalton
Isoelectric Point: 5.88
Extinction Coefficient: 100380
Gravy Index: -.45
Number of Met residues: 6
Percentage of Met residues: 1.82 %
Number of Cys residues: 4
Percentage of Cys residues: 1.22 %
SEQUENCE  amino acids 329 aa
>TM1752  TM1752 endoglucanase
MNNTIPRWRGFNLLEAFSIKSTGNFKEEDFLWMAQWDFNFVRIPMCHLLWSDRGNPFIIR
EDFFEKIDRVIFWGEKYGIHICISLHRAPGYSVNKEVEEKTNLWKDETAQEAFIHHWSFI
ARRYKGISSTHLSFNLINEPPFPDPQIMSVEDHNSLIKRTITEIRKIDPERLIIIDGLGY
GNIPVDDLTIENTVQSCRGYIPFSVTHYKAEWVDSKDFPVPEWPNGWHFGEYWNREKLLE
HYLTWIKLRQKGIEVFCGEMGAYNKTPHDVVLKWLEDLLEIFKTLNIGFALWNFRGPFGI
LDSERKDVEYEEWYGHKLDRKMLELLRKY

CDS  cDNA 987 bp
   1 ttgaataaca ccattccaag atggcgtggt ttcaaccttc tggaggcctt ttccattaaa    60
  61 agtacaggaa attttaaaga ggaagatttt ttgtggatgg ctcagtggga ctttaatttt   120
 121 gttagaatcc ctatgtgtca tcttctctgg tcagaccggg gcaacccatt tattatcaga   180
 181 gaagattttt ttgagaaaat cgatcgtgta attttctggg gagagaaata tggaatacat   240
 241 atatgtattt ctcttcacag ggcacctggc tattctgtta acaaggaagt agaagagaaa   300
 301 accaatctgt ggaaagatga aacagctcaa gaagcgttca ttcatcactg gtcttttatc   360
 361 gcacgtcgtt acaaaggaat ttcttccaca cacctgagtt ttaacttaat aaatgagcct   420
 421 ccatttcctg atccacaaat catgagtgtt gaagatcaca actctcttat caagagaact   480
 481 attacagaaa ttcgaaaaat agatcccgaa agattaatta taatagatgg attaggctat   540
 541 gggaatattc cagtggatga tttaacaatt gagaatacag tgcaatcatg cagagggtac   600
 601 attcccttca gtgttactca ttacaaagcg gaatgggtgg atagtaagga ctttcctgtt   660
 661 cctgagtggc caaatggatg gcattttggg gaatactgga acagagaaaa gttattggaa   720
 721 cattatttaa cgtggataaa actcagacaa aaaggaatag aagtattctg tggagaaatg   780
 781 ggagcttaca acaaaacacc tcacgatgtg gttttaaaat ggcttgaaga tcttttagaa   840
 841 atttttaaaa ctttgaacat agggtttgcc ttatggaatt ttagaggtcc ttttggtatt   900
 901 ttagattcgg aaaggaaaga cgttgaatac gaagaatggt atggacataa actggatagg   960
 961 aaaatgttgg aactattgag aaaatat   987
Warning: the change of start codon from ATG/M to TTG/L;
Target constructs
Download sequence in PIR or FASTA format
Chemical properties of sequence with tag
GENE PREDICTION
LEFT END RIGHT END FRAME PREDICTOR SCORE 
1728704 1729693 2 Glimmer3 score 3.41 poor
Genemark probabilities -   - -
GenemarkHMM class 2 poor

Notes

The start codon is a ATG/Methionine in most of sequences, but the GTG/V, TTG/L, CTG/I can be the start codons in some cases as expressing in E.coli. The start codon warning is labelled by RED color in sequence(sample: 10174951).

Protein sequence information contains the annotation contents from both of JCSG and SWISS-PROT. The SWISS-PROT/TrEMBL annotation is accessed from SWALL(SPTR) on the EBI SRS server. PDB homologes show both identical and highly similar proteins with released date and protein function.


Contact Webmaster JCSG Menu