LOADING...
   TM1744;TM1744
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
TM1744    TM1744            JCSG 283599 PDB Deposition 06-JAN-06              PDB id: 2fm1

Protein Sequence Information


TOPSAN
JCSG Internal annotations

ACCESSIONTM1744
DESCRIPTIONL-ALLO-threonine aldolase.
ORGANISMThermotoga maritima
COMMENT 
DR UNIPROT; Q9X266_THEMA
DR SPTR; Q9X266 (flat text); Q9X266 (good view)
DR GenBank; AAD36809
DR Pfam; PF01212; Beta_elim_lyase;
DR Interpro; IPR001597; Beta_elim_lyase;
DR PDB; 2FM1; Identical; 31-JAN-06; L-ALLO-THREONINE ALDOLASE;
DR PDB; 1JG8; Identical; 04-JUL-01; L-ALLO-THREONINE ALDOLASE;
DR PDB; 1LW4; Identical; 11-DEC-02; L-ALLO-THREONINE ALDOLASE;
DR PDB; 1LW5; Identical; 11-DEC-02; L-ALLO-THREONINE ALDOLASE;
DR PDB; 1M6S; Identical; 11-DEC-02; L-ALLO-THREONINE ALDOLASE;
DR PDB; 3WGB; Highly similar; 09-JUL-14; L-ALLO-THREONINE ALDOLASE;
DR PDB; 3WGC; Highly similar; 09-JUL-14; L-ALLO-THREONINE ALDOLASE;
DR PDB; 3WLX; Highly similar; 17-DEC-14; LOW SPECIFICITY L-THREONINE ALDOLASE;
DR FFAS; 283599; Fold and function assignment.
DR TVPC; TM1744; Homologs in PDB, JCSG and SG center.
DR OVP; TM1744; Ortholog view popup.
DR TPM; TM1744; Target PDB monitor.
DR FSS; TM1744; Target function coverage.
PROPERTY Residues: 343 aa
Molecule Weight: 37572.08 Dalton
Isoelectric Point: 6.23
Extinction Coefficient: 12950
Gravy Index: -.17
Number of Met residues: 13
Percentage of Met residues: 3.79 %
Number of Cys residues: 3
Percentage of Cys residues: 0.87 %
SEQUENCE  amino acids 343 aa
>TM1744  TM1744 L-allo-threonine aldolase
MIDLRSDTVTKPTEEMRKAMAQAEVGDDVYGEDPTINELERLAAETFGKEAALFVPSGTM
GNQVSIMAHTQRGDEVILEADSHIFWYEVGAMAVLSGVMPHPVPGKNGAMDPDDVRKAIR
PRNIHFPRTSLIAIENTHNRSGGRVVPLENIKEICTIAKEHGINVHIDGARIFNASIASG
VPVKEYAGYADSVMFCLSKGLCAPVGSVVVGDRDFIERARKARKMLGGGMRQAGVLAAAG
IIALTKMVDRLKEDHENARFLALKLKEIGYSVNPEDVKTNMVILRTDNLKVNAHGFIEAL
RNSGVLANAVSDTEIRLVTHKDVSRNDIEEALNIFEKLFRKFS

CDS  cDNA 1029 bp
   1 atgatcgatc tcaggtccga caccgttaca aaaccaacag aagagatgag aaaagccatg    60
  61 gcacaggctg aggtgggaga cgatgtgtac ggagaagatc caaccatcaa cgaactcgaa   120
 121 aggctcgccg cagagacctt tggaaaggaa gcggctctct ttgtaccctc cggcaccatg   180
 181 ggaaatcaag tgagcataat ggctcacacc cagaggggcg atgaagtgat actggaggca   240
 241 gacagccaca tcttctggta cgaggtcgga gccatggcgg ttctctccgg agtcatgccc   300
 301 catcctgtac ctggaaaaaa tggagccatg gaccccgatg atgtgaggaa ggccataaga   360
 361 cccagaaaca tacacttccc cagaacttcg ctcattgcca tcgaaaacac acacaaccgt   420
 421 tccggtggaa gagtggtccc gcttgaaaac ataaaagaga tttgcacgat agccaaagaa   480
 481 cacggcataa acgttcacat agatggtgcg aggatcttca acgcctcaat cgcttcaggt   540
 541 gttcccgtga aggagtacgc cgggtacgcc gattccgtga tgttctgtct ttcaaaaggt   600
 601 ctctgcgcac ccgtcggttc ggtggttgta ggagacaggg acttcataga aagagcgaga   660
 661 aaggcgagaa agatgctcgg tggagggatg agacaggcag gtgttctcgc tgccgctgga   720
 721 ataatcgcct tgacaaagat ggtagatcga ttgaaagaag atcatgaaaa cgccagattt   780
 781 ctcgccctga agttgaaaga aatagggtac tccgtgaatc ccgaagatgt gaaaaccaac   840
 841 atggtgattc tgaggaccga caacctgaag gtgaacgcgc acgggttcat agaagcgctc   900
 901 agaaacagcg gggtgctcgc gaacgccgta tccgacacgg agatcagact ggtaacccac   960
 961 aaagacgttt caagaaacga catagaagag gctctgaaca tcttcgaaaa actcttcaga  1020
1021 aaattctcc  1029
Target constructs
Download sequence in PIR or FASTA format
Chemical properties of sequence with tag
GENE PREDICTION
LEFT END RIGHT END FRAME PREDICTOR SCORE 
1719933 1720964 3 Glimmer3 score 15.58 good
Genemark probabilities .93   .74 good
GenemarkHMM class 1 good

Notes

The start codon is a ATG/Methionine in most of sequences, but the GTG/V, TTG/L, CTG/I can be the start codons in some cases as expressing in E.coli. The start codon warning is labelled by RED color in sequence(sample: 10174951).

Protein sequence information contains the annotation contents from both of JCSG and SWISS-PROT. The SWISS-PROT/TrEMBL annotation is accessed from SWALL(SPTR) on the EBI SRS server. PDB homologes show both identical and highly similar proteins with released date and protein function.


Contact Webmaster JCSG Menu