LOADING...
   TM1742;TM1742
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
TM1742    TM1742            JCSG 283597 PDB Deposition 04-MAR-22              PDB id: 1vjr

Protein Sequence Information


TOPSAN
JCSG Internal annotations

ACCESSIONTM1742
DESCRIPTION4-nitrophenylphosphatase (EC 3.1.3.41)
ORGANISMThermotoga maritima
COMMENT 
DR UNIPROT; Q9X264_THEMA
DR SPTR; Q9X264 (flat text); Q9X264 (good view)
DR GenBank; AAD36807
DR Pfam; PF00702; Hydrolase;
DR Interpro; IPR006357; HAD_SF_IIA;
DR Interpro; IPR005834; Dehal_like_hydro;
DR PDB; 1PW5; Identical; 02-MAR-04; NAGD PROTEIN, PUTATIVE;
DR PDB; 1VJR; Identical; 30-MAR-04; 4-NITROPHENYLPHOSPHATASE;
DR PDB; 1ZJJ; Highly similar; 29-APR-06; HYPOTHETICAL PROTEIN PH1952;
DR PDB; 3EPR; Highly similar; 04-NOV-08; HYDROLASE, HALOACID DEHALOGENASE-LIKE FAMILY;
DR PDB; 1YV9; Highly similar; 15-MAR-05; HYDROLASE, HALOACID DEHALOGENASE FAMILY;
DR PDB; 1YDF; Highly similar; 18-JAN-05; HYDROLASE, HALOACID DEHALOGENASE-LIKE FAMILY;
DR PDB; 3QGM; Highly similar; 09-FEB-11; P-NITROPHENYL PHOSPHATASE (PHO2);
DR PDB; 4JDP; Highly similar; 06-MAR-13; P-NITROPHENYL PHOSPHATASE (PHO2);
DR KEGG; 3.1.3.41; Enzyme page
DR FFAS; 283597; Fold and function assignment.
DR TVPC; TM1742; Homologs in PDB, JCSG and SG center.
DR OVP; TM1742; Ortholog view popup.
DR TPM; TM1742; Target PDB monitor.
DR FSS; TM1742; Target function coverage.
PROPERTY Residues: 259 aa
Molecule Weight: 28803.82 Dalton
Isoelectric Point: 5.58
Extinction Coefficient: 8940
Gravy Index: -.14
Number of Met residues: 7
Percentage of Met residues: 2.70 %
Number of Cys residues: 3
Percentage of Cys residues: 1.16 %
SEQUENCE  amino acids 259 aa
>TM1742  TM1742 nagD protein, putative
MLDKIELFILDMDGTFYLDDSLLPGSLEFLETLKEKNKRFVFFTNNSSLGAQDYVRKLRN
MGVDVPDDAVVTSGEITAEHMLKRFGRCRIFLLGTPQLKKVFEAYGHVIDEENPDFVVLG
FDKTLTYERLKKACILLRKGKFYIATHPDINCPSKEGPVPDAGSIMAAIEASTGRKPDLI
AGKPNPLVVDVISEKFGVPKERMAMVGDRLYTDVKLGKNAGIVSILVLTGETTPEDLERA
ETKPDFVFKNLGELAKAVQ

CDS  cDNA 777 bp
   1 gtgctggata aaatagaact cttcatttta gatatggacg ggactttcta tctggacgat    60
  61 tcgcttcttc ccggatctct ggaatttctg gagactttga aagagaaaaa caaaagattc   120
 121 gtctttttca ccaacaactc ctcgctcggc gcacaggact acgtgaggaa gctgagaaac   180
 181 atgggagtgg acgtaccgga cgatgctgtc gtaacctctg gagaaatcac cgcggagcac   240
 241 atgctgaagc ggttcggaag gtgccgtatc tttcttctgg gaacccctca gctgaagaag   300
 301 gtcttcgagg cttacggaca cgtcatagat gaggaaaatc cggattttgt ggtcctgggt   360
 361 ttcgacaaaa cgctaacgta tgaaagactg aaaaaagctt gtattttact cagaaaggga   420
 421 aaattctaca tagccaccca tccggacatc aactgtcctt cgaaagaagg acccgttcca   480
 481 gacgctggaa gcatcatggc agcgatagaa gcctcgacgg gaagaaagcc agacttgatc   540
 541 gctgggaaac ccaatccact ggttgtggat gtgatatccg agaagttcgg tgttccaaaa   600
 601 gaaagaatgg caatggtagg agacaggctg tacacggatg tgaaactggg aaagaacgcc   660
 661 gggatagtct ccattctcgt tctcaccggt gagactaccc cggaagacct tgaaagggct   720
 721 gaaacaaaac cggacttcgt cttcaaaaac cttggagaat tagccaaggc tgtccag   777
Warning: the change of start codon from ATG/M to GTG/V;
Target constructs
Download sequence in PIR or FASTA format
Chemical properties of sequence with tag
GENE PREDICTION
LEFT END RIGHT END FRAME PREDICTOR SCORE 
1718265 1719044 3 Glimmer3 score 13.36 good
Genemark probabilities .9   .84 good
GenemarkHMM class 1 good

Notes

The start codon is a ATG/Methionine in most of sequences, but the GTG/V, TTG/L, CTG/I can be the start codons in some cases as expressing in E.coli. The start codon warning is labelled by RED color in sequence(sample: 10174951).

Protein sequence information contains the annotation contents from both of JCSG and SWISS-PROT. The SWISS-PROT/TrEMBL annotation is accessed from SWALL(SPTR) on the EBI SRS server. PDB homologes show both identical and highly similar proteins with released date and protein function.


Contact Webmaster JCSG Menu