LOADING...
   TM1739;TM1739
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
TM1739    TM1739            JCSG 283594 PDB Deposition 05-MAY-31              PDB id: 1zup

Protein Sequence Information


TOPSAN
JCSG Internal annotations

ACCESSIONTM1739
DESCRIPTIONPutative nuclease with a ribonuclease H-like motif fold [TM1739-like].
ORGANISMThermotoga maritima
COMMENT 
DR UNIPROT; Q9X261_THEMA
DR SPTR; Q9X261 (flat text); Q9X261 (good view)
DR GenBank; AAD36804
DR Pfam; PF09376; NurA;
DR Interpro; IPR007363; DUF430;
DR PDB; 1ZUP; Identical; 21-JUN-05; HYPOTHETICAL PROTEIN TM1739;
DR KEGG; 3.1.-.-; Enzyme page
DR FFAS; 283594; Fold and function assignment.
DR TVPC; TM1739; Homologs in PDB, JCSG and SG center.
DR OVP; TM1739; Ortholog view popup.
DR TPM; TM1739; Target PDB monitor.
DR FSS; TM1739; Target function coverage.
PROPERTY Residues: 303 aa
Molecule Weight: 34878.26 Dalton
Isoelectric Point: 5.3
Extinction Coefficient: 18910
Gravy Index: -.43
Number of Met residues: 6
Percentage of Met residues: 1.98 %
Number of Cys residues: 1
Percentage of Cys residues: 0.33 %
SEQUENCE  amino acids 303 aa
>TM1739  TM1739 hypothetical protein
MQVRIERAERIESELEEHVGDQTFVEESRFLEEDEQREGEILDQIIFVDGKRRSFVRITT
DEGITGIFAELCVGAVIWDREGGTKTLFSPDKPPVKERVLGFSQSFQEEGYEEVGGILFK
VVKEGKDAMQSIDLYMRSLEIEEVRKHMDKNILIVKDGPAARELPFEENVGPIGLVKNIG
VTELSKEDFKKLRFLKKGKRSKMFVSSRETPLKKVGAYVKLIDGEGIRGLVRLETYVKDD
NQIPYIRKVFDDLAKTLPHLTADLPIPRLPENILPIQFLEENLSYYLTDKNYMNTRLFAY
IGR

CDS  cDNA 909 bp
   1 atgcaggtgc gtatcgaaag agcggaaaga attgaaagcg aactggaaga acacgtagga    60
  61 gatcagactt tcgtggaaga atcgagattc ctggaggaag acgagcagag agagggagaa   120
 121 attctcgatc agatcatctt cgtcgatggc aaaagaagaa gctttgtgcg gataacaaca   180
 181 gacgaaggga tcaccggtat attcgcggaa ctctgtgttg gggcggtcat ctgggataga   240
 241 gaaggtggaa cgaaaacgct cttctctcca gacaaaccac cagtcaaaga aagagtcctt   300
 301 ggattttccc aaagcttcca ggaagaagga tacgaagaag tcggaggtat tctcttcaaa   360
 361 gttgtaaaag aaggcaaaga cgccatgcaa tcgatagatc tgtacatgag gtccttggag   420
 421 atagaagaag tgagaaagca catggacaaa aacattctca tcgtgaagga tggaccagct   480
 481 gcccgggaac ttccgttcga ggaaaacgtg ggacccatcg gtcttgtgaa gaacatcggt   540
 541 gtcaccgagt tgagcaaaga ggacttcaag aaactgcgct ttctcaaaaa gggaaagcga   600
 601 agcaagatgt tcgtttcatc gagggaaaca cctctgaaaa aagtgggagc gtacgtaaaa   660
 661 ctgatcgatg gagaaggtat aaggggtctt gtcaggttag aaacctacgt gaaagacgat   720
 721 aatcagatac cgtacatcag aaaagtgttc gacgatcttg caaagacgtt accacatctc   780
 781 acggcagacc ttcccatccc aagacttccg gaaaatattc ttccgataca gtttctggaa   840
 841 gagaaccttt cgtactatct caccgacaag aactacatga acacgagact gtttgcctac   900
 901 atcgggaga   909
Target constructs
Download sequence in PIR or FASTA format
Chemical properties of sequence with tag
GENE PREDICTION
LEFT END RIGHT END FRAME PREDICTOR SCORE 
1716255 1717166 3 Glimmer3 score - -
Genemark probabilities .93   .78 good
GenemarkHMM class 1 good

Notes

The start codon is a ATG/Methionine in most of sequences, but the GTG/V, TTG/L, CTG/I can be the start codons in some cases as expressing in E.coli. The start codon warning is labelled by RED color in sequence(sample: 10174951).

Protein sequence information contains the annotation contents from both of JCSG and SWISS-PROT. The SWISS-PROT/TrEMBL annotation is accessed from SWALL(SPTR) on the EBI SRS server. PDB homologes show both identical and highly similar proteins with released date and protein function.


Contact Webmaster JCSG Menu